Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1473 IGR1474 IGR1471 IGR1475 IGR1477 IGR1472 IGR1479 IGR1476 IGR1478 fabZ, - NG1804 ompH, - NG1802 NG1805 lpxA, - NG1806 lpxD, - NG1803 dxr, - NG1799 dadA, - NG1808 NG1800 NG1807 omp85, - NG1801 fabZ, - NG1804 ompH, - NG1802 NG1805 lpxA, - NG1806 lpxD, - NG1803 dxr, - NG1799 dadA, - NG1808 NG1800 NG1807 omp85, - NG1801 fabZ, - NG1804 ompH, - NG1802 NG1805 lpxA, - NG1806 lpxD, - NG1803 dxr, - NG1799 dadA, - NG1808 NG1800 NG1807 omp85, - NG1801
* Calculated from Protein Sequence

Gene ID: NG1803

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lpxD  

Definition:
UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase

Gene Start:
1776608

Gene Stop:
1777648

Gene Length:
1041

Molecular Weight*:
36256

pI*:
6.50

Net Charge*:
-3.96

EC:
2.3.1.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Aminosugars metabolism
Butanoate metabolism
D-Arginine and D-ornithine metabolism
Ethylbenzene degradation
Glycerolipid metabolism
Histidine metabolism
Lipopolysaccharide biosynthesis
Lysine biosynthesis
Lysine degradation
Phenylalanine metabolism
Tyrosine metabolism
Valine, leucine and isoleucine degradation

Secondary Evidence:
Helander,I.M., Lindner,B., Seydel,U. and Vaara,M.
Defective biosynthesis of the lipid A component of
temperature-sensitive firA (omsA) mutant of Escherichia coli
Eur. J. Biochem. 212 (2), 363-369 (1993)
Medline: 93185653

Kelly,T.M., Stachula,S.A., Raetz,C.R. and Anderson,M.S.
The firA gene of Escherichia coli encodes
UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase. The
third step of endotoxin biosynthesis
Medline: 93374989


Dicker,I.B. and Seetharam,S.
What is known about the structure and function of the Escherichia
coli protein FirA?
Mol. Microbiol. 6 (7), 817-823 (1992)
Medline: 92292946

Vuorio,R. and Vaara,M.
Mutants carrying conditionally lethal mutations in outer membrane
genes omsA and firA (ssc) are phenotypically similar, and omsA is
allelic to firA
J. Bacteriol. 174 (22), 7090-7097 (1992)
Medline: 93054317



Comment:
For other 'lpx' genes see NG0242 (lpxK),NG1782 (lpxB), NG1806
(lpxA)and NG2065 (lpxC).

Oklahoma ID: NGO.1803

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferases. Residues 7-341 are 43% similar to this enzyme in P.aeruginosa (11352800).

Residues 4-343 are 91% similar to the enzyme in N.meningitidis (1718487).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1044
COG name: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG1044 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001451 (Bacterial transferase hexapeptide repeat) with a combined E-value of 3.9e-09.
    IPB001451    263-298
    IPB001451    227-262
    IPB001451    102-137
    IPB001451    120-155
    IPB001451    114-149
    IPB001451    245-280
    IPB001451    239-274
    IPB001451    108-143
    IPB001451    150-185
    IPB001451    233-268
    IPB001451    132-167
    IPB001451    126-161
    IPB001451    221-256
    IPB001451    96-131
    IPB001451    144-179
    IPB001451    257-292
    IPB001451    138-173
    IPB001451    156-191
    IPB001451    251-286


ProDom Summary:  Protein Domain Search
Residues 7-98 are 30% similar to a (GLUCOSAMINE N-ACYLTRANSFERASE TRANSFERASE) protein domain (PD016270) which is seen in LPXD_HAEIN.

Residues 201-301 are 35% similar to a (TRANSFERASE ACYLTRANSFERASE PROTEIN REPEAT BIOSYNTHESIS) protein domain (PD000343) which is seen in Q55612_SYNY3.



Paralogs:  Local Blast Search


NG1803 is paralogously related to NG1806 (acyl-UDP-N-acetylglucosamine O-acyltransferase (LpxA) [acyl-carrier protein]) (6e-13), NG2053 (UDP-N-acetylglucosamine pyrophosphorylase) (2e-08) and NG0085 (pilin glycosylation protein) (5e-06).


Pfam Summary:  Pfam Search
Residues 6 to 104 (E-value = 5e-46) place NG1803 in the LpxD family which is described as UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD (PF04613)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
200  
307
coil-coil  
319  
347

PDB Hit:
pdb|1LXA|1LXA UDP N-ACETYLGLUCOSAMINE ACYLTRANSFERASE 58.9 1e-09
pdb|1HV9|1HV9-A STRUCTURE OF E. COLI GLMU: ANALYSIS OF 48.8 1e-06
pdb|1HM0|1HM0-A CRYSTAL STRUCTURE OF S.PNEUMONIAE 40.2 5e-04
pdb|1G95|1G95-A CRYS

Gene Protein Sequence:
MIPATCTLSQITARLGGEWRGEDISVTAVRPLADAQAEHISFLANPKYKA
EVHDSSAGAIIVSAKAADGFEGRNLIVADDPYLYFAKVARLFSPVVKARG
GIHPTAVVEPGATVPASCEIGANAYIGANTVLGEGCRILANAVVQHDCKL
GDEVVLHPNAVVYYGCTLGRHVEIHSGAVIGADGFGLAFAGDSWFKIPQT
GAVTLGDDVEIGSNTNIDRGAMSDTTVGNGTKIDNQVQIGHNCKIGSHTV
IAAKTGISGSVTIGSYCIIGGGVGTVGHIEIADKTTIGGGTSVTHSITES
GKHLAGIFPMSEHKEWARNAVYIHRLSEMNKRLKTLEQQLSDSKDTQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTCCGGCCACCTGCACCCTGTCCCAAATCACCGCGCGGCTCGGCGG
CGAATGGCGCGGCGAGGACATTTCCGTTACCGCCGTGCGCCCGCTCGCAG
ACGCGCAGGCGGAACACATCAGCTTCCTCGCCAATCCGAAATACAAAGCC
GAAGTCCACGACAGCAGCGCGGGCGCGATCATCGTTTCCGCCAAAGCAGC
AGACGGATTTGAAGGGCGCAACCTGATTGTCGCCGACGATCCCTATCTCT
ATTTCGCCAAAGTCGCGCGCCTGTTTTCACCCGTCGTCAAAGCGCGCGGC
GGCATCCATCCGACCGCCGTCGTCGAACCGGGCGCGACCGTTCCCGCAAG
CTGTGAAATCGGCGCGAACGCCTACATCGGCGCGAACACCGTGCTCGGCG
AAGGCTGCCGCATCTTGGCAAACGCCGTCGTCCAACACGATTGCAAACTG
GGCGACGAAGTCGTCCTGCATCCCAACGCCGTCGTTTATTACGGCTGCAC
ACTCGGCAGACACGTCGAAATCCACAGCGGCGCGGTCATCGGCGCGGACG
GTTTCGGACTCGCCTTCGCCGGCGATTCGTGGTTCAAAATCCCGCAAACC
GGCGCGGTAACGCTGGGCGACGACGTAGAAATCGGCTCGAACACCAACAT
CGACCGCGGCGCGATGAGCGACACCACCGTCGGCAACGGCACCAAAATCG
ACAACCAAGTCCAAATCGGACACAACTGCAAAATCGGTTCGCACACCGTC
ATCGCCGCCAAAACCGGCATCTCAGGCAGCGTAACCATAGGCAGCTACTG
CATCATCGGCGGCGGCGTCGGTACGGTCGGACACATCGAAATCGCCGACA
AAACCACCATCGGCGGCGGCACGTCCGTTACCCACAGCATTACCGAAAGC
GGCAAACACCTTGCCGGCATCTTCCCGATGTCCGAGCATAAAGAATGGGC
GCGCAACGCCGTTTACATCCACCGCTTAAGCGAAATGAACAAACGCCTCA
AAACGCTGGAACAGCAGCTTTCAGACAGCAAAGACACGCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy