Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1466.1 IGR1469 IGR1473 IGR1474 IGR1471 IGR1468 IGR1470 IGR1472 IGR1466 IGR1467 R.NgoII, - NG1794.1 ompH, - NG1802 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 omp85, - NG1801 R.NgoII, - NG1794.1 ompH, - NG1802 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 omp85, - NG1801 ompH, - NG1802 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1800 omp85, - NG1801 R.NgoPII, - NG1794 NG1793 R.NgoII, - NG1794.1 R.NgoPII, - NG1794
* Calculated from Protein Sequence

Gene ID: NG1799

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dxr  

Definition:
1-deoxy-D-xylulose 5-phosphate reductoisomerase

Gene Start:
1771015

Gene Stop:
1772196

Gene Length:
1182

Molecular Weight*:
42011

pI*:
6.30

Net Charge*:
-4.67

EC:
1.1.1.267  

Functional Class:
Central intermediary metabolism; Other  

Pathway: pathway table
Sterol biosynthesis

Secondary Evidence:
Altincicek,B., Hintz,M., Sanderbrand,S., Wiesner,J., Beck,E. and
Jomaa,H.
Tools for discovery of inhibitors of the 1-deoxy-D-xylulose
5-phosphate (DXP) synthase and DXP reductoisomerase: an approach
with enzymes from the pathogenic bacterium Pseudomonas aeruginosa
FEMS Microbiol. Lett. 190 (2), 329-333 (2000)
Medline: 20487113

Takahashi,S., Kuzuyama,T., Watanabe,H. and Seto,H.
A 1-deoxy-D-xylulose 5-phosphate reductoisomerase catalyzing the
formation of 2-C-methyl-D-erythritol 4-phosphate in an alternative
nonmevalonate pathway for terpenoid biosynthesis
Proc. Natl. Acad. Sci. U.S.A. 95 (17), 9879-9884 (1998)
Medline: 98374274

Radykewicz,T., Rohdich,F., Wungsintaweekul,J., Herz,S., Kis,K.,
Eisenreich,W., Bacher,A., Zenk,M.H. and Arigoni,D.
Biosynthesis of terpenoids: 1-deoxy-D-xylulose-5-phosphate
reductoisomerase from Escherichia coli is a class B dehydrogenase
FEBS Lett. 465 (2-3), 157-160 (2000)
Medline: 20123893




Comment:
This enzyme forms part of an alternative nonmevalonate pathway for terpenoid biosynthesis.

Oklahoma ID: NGO.1799

Blast Summary:  PSI-Blast Search
Residues 1-394 are 89% similar to 1-deoxy-D-xylulose 5-phosphate reductoisomerase from Neisseria meningitidis group A strain Z2491 (11279941|).

Numerous hits in gapped BLAST to 1-deoxy-d-xylulose 5-phosphate reductoisomerase sequences,e.g.residues 3-376 are 56% similar to Pseudomonas aeruginosa strain PAO1 (11347257|).Residues 6-354 are 57% similar to 1-deoxy-D-xylulose 5-phosphate reductoisomerase / putative ATP-binding component of a transport system from Escherichia coli (3434984|) (gb|AAC73284.1|).Residues 6-353 are 37% similar to 1-deoxy-d-xylulose 5-phosphate reductoisomerase from Chlamydia trachomatis serotype D, strain UW3/Cx (8134413|).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0743
COG name: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (terpenoid biosynthesis)
Functional Class:  I
The phylogenetic pattern of COG0743 is -----qvcebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003821 (1-deoxy-D-xylulose 5-phosphate reductoisomerase) with a combined E-value of 4e-120.
    IPB003821A    8-22
    IPB003821B    99-134
    IPB003821C    198-236
    IPB003821D    243-286
    IPB003821E    331-353


ProDom Summary:  Protein Domain Search
Residues 90-354 are 59% similar to a (1-DEOXY-D-XYLULOSE 5-PHOSPHATE) protein domain (PD010039) which is seen in DXR_ECOLI.

Residues 6-85 are 53% similar to a (1-DEOXY-D-XYLULOSE 5-PHOSPHATE) protein domain (PD186282) which is seen in DXR_ECOLI.



Paralogs:  Local Blast Search

NG1799 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 386 (E-value = 4.7e-193) place NG1799 in the DXP_reductoisom family which is described as 1-deoxy-D-xylulose 5-phosphate reductoisomerase (PF02670)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
154
transmembrane  
99  
115

PDB Hit:
pdb|1JVS|1JVS-A CRYSTAL STRUCTURE OF 1-DEOXY-D-XYLULOSE 388.0 0e+00
pdb|1K5H|1K5H-A 1-DEOXY-D-XYLULOSE-5-PHOSPHATE REDUCTOISOMERASE 389.0 0e+00

Gene Protein Sequence:
MTPQVLTILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLAAQCQT
FRPEYAVVADAEHAARLEALLKRDGTATQVLHGAQALVDVASADEVSGVM
CAIVGAAGLPSALAAAQKGKTIYLANKETLVVSGALFMETARANGAAVLP
VDSEHNAIFQVLPRDYTDRLNEHGIDSIILTASGGPFLTTDLSTFDSITP
EQAVKHPNWRMGRKISVDSATMANKGLELIEAHWLFNCPPDKLEVVIHPQ
SVIHSMVRYRDGSVLAQLGNPDMRTPIAYCLGLPERIDSGVGKLDFGALS
ALTFQKPDFGRFPCLKFAYETINAGGAAPCVLNAANETAVAAFLDGQIKF
TDIAKTVAHCLAQDFSNGMGDIEGLLAQDARTRAQARAFIGTLR

Gene Nucleotide Sequence:  Sequence Viewer
ATGACACCACAAGTCCTGACCATATTAGGCAGTACCGGCAGCATAGGCGA
AAGCACGCTGGACGTTGTCTCCCGCCATCCCGAAAAATTCCGCGTATTCG
CGCTGGCAGGGCATAAGCAGGTCGAGAAACTGGCGGCTCAATGTCAAACG
TTCCGCCCCGAATATGCCGTCGTTGCCGATGCCGAACACGCCGCCCGGCT
TGAAGCCCTGTTGAAACGCGACGGCACGGCGACTCAGGTTTTACACGGCG
CGCAGGCATTGGTTGACGTTGCGTCTGCCGACGAAGTCAGCGGCGTCATG
TGCGCCATCGTCGGGGCGGCGGGGCTGCCTTCCGCGCTCGCAGCGGCGCA
AAAAGGCAAAACCATTTATCTGGCAAACAAAGAAACGCTGGTGGTTTCCG
GCGCGTTGTTTATGGAAACCGCCCGCGCAAACGGCGCGGCAGTGTTGCCC
GTCGACAGCGAACACAACGCCATTTTCCAAGTTTTGCCGCGCGATTACAC
AGACCGTCTGAACGAACACGGCATCGATTCGATTATCCTGACCGCTTCCG
GCGGCCCGTTTTTAACAACCGATTTAAGCACGTTCGACAGCATTACGCCC
GAGCAGGCGGTCAAACACCCCAATTGGCGTATGGGGCGCAAAATCTCCGT
CGATTCAGCCACTATGGCAAACAAGGGCTTGGAACTGATTGAAGCGCATT
GGCTGTTCAACTGTCCGCCCGACAAACTCGAAGTCGTCATCCATCCCCAA
TCCGTGATACACAGTATGGTGCGCTACCGCGACGGCTCCGTGCTGGCGCA
ACTGGGCAATCCCGATATGCGAACGCCCATCGCCTATTGTTTGGGCTTGC
CCGAGCGCATCGATTCGGGTGTCGGCAAACTCGATTTCGGCGCATTGTCC
GCGCTGACCTTCCAAAAGCCCGACTTCGGCCGCTTCCCCTGCCTGAAGTT
CGCCTATGAAACCATAAACGCAGGCGGAGCCGCGCCCTGCGTATTGAACG
CCGCCAACGAAACCGCCGTCGCCGCCTTTTTGGACGGACAGATTAAGTTT
ACCGACATTGCCAAAACCGTCGCCCACTGTCTTGCACAAGACTTTTCAAA
CGGCATGGGCGATATAGAAGGACTGTTGGCGCAAGATGCCCGGACACGCG
CACAAGCGCGGGCATTTATCGGCACACTGCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy