Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1466.1 IGR1469 IGR1471 IGR1470 IGR1468 IGR1472 IGR1466 IGR1467 R.NgoII, - NG1794.1 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 omp85, - NG1801 R.NgoII, - NG1794.1 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 omp85, - NG1801 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 omp85, - NG1801 R.NgoPII, - NG1794 R.NgoII, - NG1794.1 R.NgoPII, - NG1794
* Calculated from Protein Sequence

Gene ID: NG1798

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cdsA  

Definition:
phosphatidate cytidylyltransferase

Gene Start:
1770162

Gene Stop:
1770956

Gene Length:
795

Molecular Weight*:
29132

pI*:
8.60

Net Charge*:
4.71

EC:
2.7.7.41  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Taguchi,K., Fukutomi,H., Kuroda,A., Kato,J. and Ohtake,H.
Cloning of the Pseudomonas aeruginosa gene encoding CDP-diglyceride synthetase
Gene 172 (1), 165-166 (1996)
Medline: 96257274

Taguchi,K., Fukutomi,H., Kuroda,A., Kato,J. and Ohtake,H.
Cloning of the Pseudomonas aeruginosa gene encoding CDP-diglyceride synthetase
Gene 172 (1), 165-166 (1996)
Medline: 96257274

Mulligan,R.C. and Berg,P.
Factors governing the expression of a bacterial gene in mammalian
cells
Mol. Cell. Biol. 1 (5), 449-459 (1981)
Medline: 88094360


Sparrow,C.P. and Raetz,C.R.
Purification and properties of the membrane-bound CDP-diglyceride
synthetase from Escherichia coli
J. Biol. Chem. 260 (22), 12084-12091 (1985)
Medline: 86008269

Richardson,K.K., Fostel,J. and Skopek,T.R.
Nucleotide sequence of the xanthine guanine phosphoribosyl
transferase gene of E. coli
Nucleic Acids Res. 11 (24), 8809-8816 (1983)
Medline: 84169517

Pratt,D. and Subramani,S.
Nucleotide sequence of the Escherichia coli xanthine-guanine
phosphoribosyl transferase gene
Nucleic Acids Res. 11 (24), 8817-8823 (1983)
Medline: 84169518






Comment:
Oklahoma ID: NGO.1798

Blast Summary:  PSI-Blast Search
Residues 1-265 are 96% similar to phosphatidate cytidylyltransferase from Neisseria meningitidis group A strain Z2491 (7378855|).

Numerous hits in gapped BLAST to phosphatidate cytidylyltransferase sequences,e.g.residues 1-261 are 43% similar to phosphatidate cytidylyltransferase from Pseudomonas aeruginosa strain PAO1 (gb|AAG07039.1|).Residues 37-261 are 34% similar to phosphatidate cytidylyltransferase from Escherichia coli (4902916|).Residues 4-257 are 26% similar to phosphatidate cytidylyltransferase from syphilis spirochete, Treponema pallidum (7521301|).




COGS Summary:  COGS Search
BeTs to 14 clades of COG0575
COG name: CDP-diglyceride synthetase
Functional Class:  I
The phylogenetic pattern of COG0575 is amtkyqvcEbrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000374 (Phosphatidate cytidylyltransferase) with a combined E-value of 2.3e-28.
    IPB000374A    165-177
    IPB000374B    222-249


ProDom Summary:  Protein Domain Search
Residues 135-260 are 57% similar to a (PHOSPHATIDATE CYTIDYLYLTRANSFERASE SYNTHASE) protein domain (PD002096) which is seen in CDSA_PSEAE.



Paralogs:  Local Blast Search


NG1798 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 264 (E-value = 1.6e-87) place NG1798 in the CTP_transf_1 family which is described as Cytidylyltransferase family (PF01148)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
184
cleavable N-terminal sequence  
1  
29
transmembrane  
58  
74
transmembrane  
78  
94
transmembrane  
109  
125
transmembrane  
132  
148
transmembrane  
204  
220
transmembrane  
248  
264

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MLKQRVITAMWLLPLMLGMLFYAPQWLWAAFCGLIALTALWEYARMAGLC
KTETNHYLAATLVFGVVAYAGGWMLPNLVWYVVLAFWLAVMPLWLRFKWR
LNGGWQVYAVGWLLLMPFWFALVSLRPHPDDALPLLAVMGLVWVADVCAY
FSGKALGKHKIAPAISPGKSWEGAIGGAVCVAVYMTAVRSAGWLAFDTGW
FDTVLIGLVLTVVSVCGDLLESWLKRAAGIKDSSNLLPGHGGVFDRTDSL
IAVISVYAAIMSVLN

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGAAACAACGGGTAATAACCGCTATGTGGCTGCTGCCGCTGATGCT
GGGCATGCTGTTTTACGCGCCGCAATGGCTGTGGGCTGCATTTTGCGGGC
TGATTGCCCTGACCGCCTTGTGGGAGTATGCCCGTATGGCCGGTTTGTGC
AAAACCGAAACCAACCATTACCTCGCCGCAACCTTGGTTTTCGGCGTAGT
TGCCTATGCGGGCGGCTGGATGCTGCCTAATTTGGTTTGGTATGTTGTTT
TGGCATTTTGGCTCGCCGTTATGCCTTTGTGGTTGAGATTCAAATGGAGG
CTCAACGGCGGTTGGCAGGTTTATGCCGTCGGCTGGCTTTTGCTCATGCC
GTTTTGGTTCGCGCTCGTATCCCTGCGCCCGCATCCCGATGATGCCCTGC
CGCTGCTCGCCGTGATGGGTTTGGTCTGGGTTGCCGACGTTTGCGCGTAT
TTCAGCGGCAAGGCGCTCGGCAAACACAAAATCGCACCGGCAATCAGCCC
CGGCAAGAGCTGGGAAGGCGCAATCGGCGGTGCGGTTTGCGTGGCAGTGT
ACATGACTGCCGTACGAAGTGCCGGCTGGCTGGCATTCGATACAGGCTGG
TTCGATACCGTGTTAATCGGTTTGGTGTTGACCGTTGTCAGCGTATGCGG
CGACCTGTTGGAAAGCTGGCTCAAGCGCGCGGCAGGCATCAAAGACAGCA
GCAACCTGCTGCCCGGACACGGCGGCGTGTTCGACCGTACCGACAGCCTG
ATTGCCGTTATCAGCGTCTATGCGGCGATAATGTCGGTTTTAAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy