Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-2 IGR1466.1 IGR1469 IGR1471 IGR1465 IGR1468 IGR1470 IGR1472 IGR1464 IGR1466 IGR1467 NG1792 R.NgoII, - NG1794.1 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 omp85, - NG1801 NG1792 R.NgoII, - NG1794.1 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 omp85, - NG1801 NG1792 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 omp85, - NG1801 R.NgoPII, - NG1794 R.NgoII, - NG1794.1 R.NgoPII, - NG1794
* Calculated from Protein Sequence

Gene ID: NG1797

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
uppS  

Definition:
probable undecaprenyl pyrophosphate synthetase

Gene Start:
1769413

Gene Stop:
1770156

Gene Length:
744

Molecular Weight*:
28331

pI*:
8.40

Net Charge*:
2.41

EC:
2.5.1.31  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table

Secondary Evidence:
Apfel,C.M., Takacs,B., Fountoulakis,M., Stieger,M. and Keck,W.
Use of genomics to identify bacterial undecaprenyl pyrophosphate
synthetase: cloning, expression, and characterization of the
essential uppS gene
J. Bacteriol. 181 (2), 483-492 (1999)
Medline: 99102211

Kato,J., Fujisaki,S., Nakajima,K., Nishimura,Y., Sato,M. and
Nakano,A.
The Escherichia coli homologue of yeast RER2,a key enzyme of dolichol synthesis, is essential for carrier lipid formation in
bacterial cell wall synthesis
J. Bacteriol. 181 (9), 2733-2738 (1999)
Medline: 99235750



Comment:
For 'upp' genes see NG0353 (upp)

Oklahoma ID: NGO.1797

Blast Summary:  PSI-Blast Search
Residues 1-248 are 97% similar to undecaprenyl pyrophosphate synthetase from Neisseria meningitidis group B strain MD58 (gb|AAF40643.1|).

Numerous hits in gapped BLAST to undecaprenyl pyrophosphate synthetase sequences,e.g. residues 14-241 are 57% similar to undecaprenyl pyrophosphate synthetase from Pseudomonas aeruginosa strain PAO1 (gb|AAG07040.1|).Residues 1-237 are 52% similar to undecaprenyl pyrophosphate synthetase from Escherichia coli
O157:H7 (13359632|).Residues 6-236 are 39% similar to a undecaprenyl pyrophosphate synthetase from Chlamydia trachomatis serotype D,strain UW3/Cx (gb|AAC68050.1|).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0020
COG name: Undecaprenyl pyrophosphate synthase
Functional Class:  I
The phylogenetic pattern of COG0020 is AmtkYqvcebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001441 (Undecaprenyl pyrophosphate synthetase family) with a combined E-value of 1.5e-84.
    IPB001441A    15-29
    IPB001441B    58-85
    IPB001441C    128-155
    IPB001441D    178-215


ProDom Summary:  Protein Domain Search
Residues 21-235 are 54% similar to a (TRANSFERASE PROTEIN UNDECAPRENYL) protein domain (PD003461) which is seen in UPPS_HAEIN.



Paralogs:  Local Blast Search


NG1797 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 21 to 236 (E-value = 5.8e-112) place NG1797 in the UPP_synthetase family which is described as Putative undecaprenyl diphosphate synthase (PF01255)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
87  
130

PDB Hit:
pdb|1JP3|1JP3-A STRUCTURE OF E.COLI UNDECAPRENYL PYROPHOSPHATE 253.0 3e-68
pdb|1F75|1F75-A CRYSTAL STRUCTURE OF UNDECAPRENYL DIPHOSPHATE 206.0 2e-54
pdb|1JP3|1JP3-A STRUCTURE OF E.COLI UNDECAPRENYL PYROPHOSPHATE 381.0 0e+00
pdb|1F75|1F75-A CRYS

Gene Protein Sequence:
MKSSTQTILEHTAIPRHIAVIMDGNGRWAKKRFLPRIMGHKRGLDALENM
VKHCAKLGVQYLTVFAFSTENWRRPEDEVSFLMGLFLQALQKQVRRLHEN
NMRLKILGSRERFNRQILQGIEEAEALTANNTGLTLSIAADYGGRWDILQ
AANKLIAEGVSEITEDTLAKHLMLGDAPEPDLFIRTGGETRISNFLLWQM
AYAELYFTDILWPDFDETALDAAVASFQKRERRFGRTSEQLPIGQQRN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGAGCAGCACGCAGACCATTTTGGAACACACCGCCATCCCGAGGCA
CATCGCCGTAATTATGGACGGCAACGGCCGTTGGGCGAAAAAACGTTTTC
TCCCGCGTATAATGGGACACAAACGCGGCTTGGACGCGTTGGAAAATATG
GTGAAGCATTGCGCCAAACTGGGCGTGCAATATCTGACCGTGTTTGCCTT
TTCAACCGAAAACTGGCGTCGCCCCGAAGACGAAGTTTCGTTCCTGATGG
GGCTGTTTTTACAGGCTTTGCAAAAACAGGTACGCCGCCTGCACGAAAAC
AATATGCGCCTGAAAATATTGGGCAGCCGCGAACGCTTTAATCGGCAGAT
TCTGCAAGGTATCGAAGAGGCGGAAGCCTTGACGGCAAATAATACCGGTC
TGACCCTGAGCATTGCTGCGGATTACGGCGGCCGCTGGGATATTTTGCAG
GCGGCAAACAAACTGATTGCCGAAGGCGTATCCGAGATTACGGAAGACAC
GCTGGCCAAACACTTGATGCTGGGCGACGCGCCGGAACCGGATTTGTTCA
TCCGCACGGGCGGAGAAACGCGCATCAGCAATTTCCTGCTCTGGCAGATG
GCGTATGCAGAACTGTATTTCACCGACATCCTGTGGCCCGATTTCGACGA
AACCGCCTTAGATGCCGCCGTCGCTTCGTTCCAAAAACGCGAACGGCGGT
TCGGACGCACTTCCGAGCAACTGCCTATCGGACAGCAAAGGAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy