Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-2 IGR1466.1 IGR1469 IGR1471 IGR1465 IGR1468 IGR1470 IGR1464 IGR1463 IGR1466 IGR1467 IGR1462 NG1792 gidB, - NG1791 sopA,parA, - NG1790 R.NgoII, - NG1794.1 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 NG1792 gidB, - NG1791 sopA,parA, - NG1790 R.NgoII, - NG1794.1 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 NG1792 gidB, - NG1791 sopA,parA, - NG1790 frr, - NG1796 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 R.NgoPII, - NG1794 R.NgoII, - NG1794.1 R.NgoPII, - NG1794
* Calculated from Protein Sequence

Gene ID: NG1795

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
NgoPII  dcmH  

Definition:
site-specific DNA-methyltransferase (cytosine-specific)

Gene Start:
1767633

Gene Stop:
1768655

Gene Length:
1023

Molecular Weight*:
38431

pI*:
8.50

Net Charge*:
4.03

EC:
2.1.1.37  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Methionine metabolism

Primary Evidence:
Sullivan,K.M.and Saunders,J.R., Sequence analysis of the NgoPII methyltransferase gene from Neisseria gonorrhoeae P9:homologies with other enzymes recognizing the sequence 5'-GGCC-3', Nucleic Acids Res. 16(10),4369-4387(1988), Medline: 88247748

Sullivan,K.M. and Saunders,J.R., Nucleotide sequence and genetic organization of the NgoPII restriction-modification system of Neisseria gonorrhoeae, Mol.Gen.Genet.216, 380-387(1989), Medline: 89313677

Stein,D.C., Gunn,J.S. and Piekarowicz,A. Sequence similarities between
the genes encoding the S.NgoI and HaeII restriction/modification
systems. Biol. Chem. 379 (4-5), 575-578 (1998) M:98290322 Labbe,D.,
Holtke,H.J. and Lau,P.C. Cloning and characterization of two tandemly
arranged DNA methyltransferase genes of Neisseria lactamica: an
adenine-specific M.NlaIII and a cytosine-type methylase Mol. Gen. Genet.
224 (1), 101-110 (1990) M:91117164 Stein,D.C., Gunn,J.S., Radlinska,M.
and Piekarowicz,A. Restriction and modification systems of Neisseria
gonorrhoeae Gene 157 (1-2), 19-22 (1995) M:95331562 Sullivan,K.M. and
Saunders,J.R. Sequence analysis of the NgoPII methyltransferase gene
from Neisseria gonorrhoeae P9: homologies with other enzymes recognizing
the sequence 5'-GGCC-3' Nucleic Acids Res. 16 (10), 4369-4387 (1988)
M:88247748 Sullivan,K.M. and Saunders,J.R. Nucleotide sequence and
genetic organization of the NgoPII restriction-modification system of
Neisseria gonorrhoeae Mol. Gen. Genet. 216 (2-3), 380-387 (1989)
M:89313677 Gunn,J.S. and Stein,D.C. Natural variation of the NgoII
restriction-modification system of Neisseria gonorrhoeae Gene 132 (1),
15-20 (1993) M:94010340 Stein,D.C., Chien,R. and Seifert,H.S.
Construction of a Neisseria gonorrhoeae MS11 derivative deficient in
NgoMI restriction and modification J. Bacteriol. 174 (15), 4899-4906
(1992) M:92332422
Gunn,J.S.and Stein,D.C., Natural variation of the NgoII restriction-modification system of Neisseria gonorrhoeae, Gene 132(1),15-20(1993), Medline: 94010340

Gunn,J.S.and Stein,D.C.
The Neisseria gonorrhoeae S.NgoVIII restriction/modification system: a type IIs system homologous to the Haemophilus parahaemolyticus HphI restriction/modification system, Nucleic Acids Res.25(20),4147-4152(1997), Medline: 97465963


Secondary Evidence:
Stankevicius,K., Povilionis,P., Lubys,A., Menkevicius,S. and
Janulaitis,A.
Cloning and characterization of the unusual
restriction-modification system comprising two restriction
endonucleases and one methyltransferase
Gene 157 (1-2), 49-53 (1995)
Medline: 95331599

Posfai,G.,Kiss,A.,Erdei,S.,Posfai,J.and Venetianer,P, Structure of the Bacillus sphaericus R modification methylase, J.Mol.Biol.170(3), 597-610(1983), Medline: 84036221.



Comment:
For other 'ngo'genes see NG1991 (ngoI), NG0675 (rngoV),NG0676
(mngoV).

For other 'dcm' genes see NG0365 (dcmG), NG0873 (dcmD) ,NG1894
(dcmH) and NG1991 (dcm).

Oklahoma ID: NGO.1795

Blast Summary:  PSI-Blast Search
NG1795 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 293960,site-specific DNA-methyltransferase (cytosine-specific)

No hits to N.meningitidis found.

Numerous significant hits in gapped BLAST to cytosine methylase; e.g residues 12-340 is 64% similar to HaeIII DNA modification methyltransferase of Haemophilus influenzae biogroup
aegyptius AF051375,residues 60-328 are 33% similar to DNA cytosine methyltransferaseMET2a of Zea mays (gb|AAK11516.1|).


COGS Summary:  COGS Search
BeTs to 7 clades of COG0270
COG name: Site-specific DNA methylase dcm
Functional Class:  L
The phylogenetic pattern of COG0270 is -Mtk---ceB-hUJ-------
Number of proteins in this genome belonging to this COG is 8

Blocks Summary:  Blocks Search
***** IPB001525 (C-5 cytosine-specific DNA methylase) with a combined E-value of 1.2e-67.
    IPB001525A    15-28
    IPB001525B    76-91
    IPB001525C    100-127
    IPB001525D    147-173
    IPB001525E    288-303
    IPB001525F    316-325


ProDom Summary:  Protein Domain Search
Residues 78-192 are identical to a (METHYLTRANSFERASE TRANSFERASE METHYLASE MODIFICATION) protein domain (PD000445) which is seen in Q59604_NEIGO.

Residues 237-340 are identical to a (METHYLTRANSFERASE TRANSFERASE METHYLASE MODIFICATION) protein domain (PD000554) which is seen in MTNG_NEIGO.

Residues 193-236 are identical to a (METHYLTRANSFERASE MODIFICATION METHYLASE) protein domain (PD021368) which is seen in Q59612_NEIGO.

Residues 15-73 are identical to a (METHYLTRANSFERASE TRANSFERASE METHYLASE MODIFICATION) protein domain (PD000515) which is seen in MTNG_NEIGO.



Paralogs:  Local Blast Search


NG1795 is paralogously related to NG0365 (site-specific DNA-methyltransferase (cytosine-specific) NgoVII) (2e-39), NG1894 (5-methylcytosine methyltransferase) (5e-38), NG0873 (DNA modification methylase) (4e-32), NG1991 (cytosine DNA methylase M.NgoI) (2e-31), NG0676 (modification methylase M.NgoV (site-specific DNA-methyltransferase)) (3e-26), NG1209 (DNA (cytosine-5-)-methyl transferase) (2e-23) and NG1175 (cytosine specific DNA methyltransferase) (0.001).


Pfam Summary:  Pfam Search
Residues 12 to 337 (E-value = 3e-153) place NG1795 in the DNA_methylase family which is described as C-5 cytosine-specific DNA methylase (PF00145)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1DCT|1DCT-A DNA (CYTOSINE-5) METHYLASE FROM HAEIII 427.0 0e+00
pdb|10MH|10MH-A TERNARY STRUCTURE OF HHAI METHYLTRANSFERASE WITH138.0 2e-33
pdb|1FJX|1FJX-A STRUCTURE OF TERNARY COMPLEX OF HHAI 137.0 3e-33
pdb|1G55|1G55-A STRU

Gene Protein Sequence:
MQNSSPTTYNPMKIISLFSGCGGLDLGFEKAGFEIPAANEYDKTIWATFK
ANHPKTHLIEGDIRKIKEEDFPEEIDGIIGGPPCQSWSEAGALRGIDDAR
GQLFFDYIRILKSKQPKFFLAENVSGMLANRHNGAVQNLLKMFDGCGYDV
TLTMANAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVEDKDKITLKD
VIWDLQDTAVPSAPQNKTNPDAVNNNEYFTGSFSPIFMSRNRVKAWDEQG
FTVQASGRQCQLHPQAPKMEKHGANDYRFAAGKETLYRRMTVREVARIQG
FPDNFKFIYQNVNDAYKMIGNAVPVNLAYEIAAAIKKTLER

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAACTCATCACCTACCACTTATAATCCTATGAAAATCATTAGTTT
GTTTAGCGGTTGCGGCGGTTTGGATTTGGGTTTCGAAAAAGCGGGATTTG
AAATCCCCGCCGCCAACGAATACGATAAAACCATTTGGGCAACCTTCAAG
GCAAACCATCCAAAGACCCATTTGATAGAAGGCGATATACGCAAGATTAA
AGAAGAAGATTTCCCTGAAGAAATCGACGGGATTATCGGCGGCCCACCCT
GCCAGTCTTGGTCTGAAGCGGGAGCTTTGCGCGGCATCGACGATGCGCGC
GGACAGTTGTTTTTCGACTACATCCGTATTTTGAAAAGCAAACAGCCAAA
ATTCTTTTTAGCGGAAAACGTCAGCGGAATGCTGGCAAACCGCCACAACG
GAGCCGTACAAAACCTGCTGAAAATGTTTGACGGATGCGGATACGACGTA
ACCTTGACTATGGCCAACGCCAAAGACTACGGTGTAGCACAGGAACGCAA
AAGGGTCTTCTACATCGGTTTCCGTAAAGACTTGGAAATAAAATTTTCTT
TTCCAAAAGGTTCGACGGTCGAAGACAAAGACAAGATTACATTGAAAGAC
GTTATTTGGGATTTGCAGGACACAGCCGTACCTTCCGCCCCGCAAAACAA
GACCAACCCCGACGCAGTCAACAACAACGAATATTTTACCGGCAGTTTTT
CCCCTATTTTTATGAGCCGGAACCGAGTTAAAGCGTGGGATGAACAGGGT
TTTACCGTCCAAGCTTCAGGCAGGCAGTGCCAACTGCACCCGCAAGCCCC
AAAGATGGAAAAGCACGGGGCAAACGACTACCGTTTTGCTGCCGGCAAAG
AAACACTATATCGGAGGATGACGGTACGCGAAGTTGCAAGAATCCAAGGC
TTTCCCGACAACTTCAAATTCATCTATCAAAATGTCAACGACGCATACAA
AATGATTGGCAACGCCGTCCCCGTCAACCTTGCCTACGAAATTGCAGCGG
CAATTAAAAAAACCCTAGAAAGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy