Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-2 IGR1466.1 IGR1469 IGR1471 IGR1465 IGR1468 IGR1470 IGR1464 IGR1463 IGR1466 IGR1467 IGR1462 NG1792 gidB, - NG1791 sopA,parA, - NG1790 R.NgoII, - NG1794.1 frr, - NG1796 rnhB, - NG1789 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 NG1792 gidB, - NG1791 sopA,parA, - NG1790 R.NgoII, - NG1794.1 frr, - NG1796 rnhB, - NG1789 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 NG1792 gidB, - NG1791 sopA,parA, - NG1790 frr, - NG1796 rnhB, - NG1789 uppS, - NG1797 cdsA, - NG1798 NgoPII,dcmH, - NG1795 dxr, - NG1799 NG1793 NG1800 R.NgoPII, - NG1794 R.NgoII, - NG1794.1 R.NgoPII, - NG1794
* Calculated from Protein Sequence

Gene ID: NG1794.1

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
R.NgoII  

Definition:
NgoII restriction endonuclease

Gene Start:
1767113

Gene Stop:
1767631

Gene Length:
519

Molecular Weight*:
19827

pI*:
10.60

Net Charge*:
13.09

EC:
3.1.21.4  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Primary Evidence:
Gunn,J.S. and Stein,D.C.
Natural variation of the NgoII restriction-modification system of
Neisseria gonorrhoeae
Gene 132 (1), 15-20 (1993)
MEDLINE: 94010340

Gunn,J.S. and Stein,D.C.
Use of a non-selective transformation technique to construct a
multiply restriction/modification-deficient mutant of Neisseria
gonorrhoeae
Mol. Gen. Genet. 251 (5), 509-517 (1996)
MEDLINE: 96323024


Comment:


Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously entered 1399075 in GenBank, a NgoII restriction endonuclease. See also X52661, NgoPII restriction and modification from Neisseria gonorrhoeae. Residues 2-173 are 48% similar to 2961230, a FnuDI restriction endonuclease from Fusobacterium nucleatum.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG1794.1 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
IAATQNQSSLLMTACLQKPAKMRKNGKRKTLSIIVGVVDKKKNLKHLAMV
YGIDYCADAECYLKIKNQIKEGIGNIGGIQFAETKELGRVNRIDPLNITY
LRVRGMWGIENPWFVFNYIYQRNMEKSFNFMAIINEDKWNSFNNTDKLLA
IQDSKLAISDIKIKNPNNPARLR

Gene Nucleotide Sequence:  Sequence Viewer
ATAGCAGCCACCCAAAATCAAAGCTCTCTGTTGATGACAGCATGCTTACA
AAAGCCTGCAAAGATGCGGAAAAATGGGAAGAGAAAGACATTATCTATAA
TTGTCGGCGTCGTTGACAAAAAGAAAAACCTCAAACACTTGGCAATGGTT
TACGGAATCGACTACTGCGCCGATGCCGAATGCTATTTGAAGATAAAAAA
TCAAATTAAGGAAGGAATCGGCAACATCGGCGGCATACAGTTTGCAGAAA
CCAAAGAGCTGGGCAGGGTCAACCGCATTGATCCGCTCAACATAACTTAT
CTGAGAGTACGGGGTATGTGGGGAATCGAAAATCCATGGTTTGTCTTCAA
CTATATTTACCAACGGAATATGGAAAAAAGTTTCAATTTCATGGCCATTA
TCAACGAAGACAAATGGAACAGTTTTAACAATACAGACAAGCTGCTTGCC
ATACAGGATTCCAAACTGGCCATTTCCGACATTAAAATTAAAAATCCCAA
CAACCCGGCGCGATTAAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy