Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-2 IGR1461 IGR1465 IGR1464 IGR1463 IGR1466 IGR1459 IGR1460 IGR1458 IGR1462 NG1792 gidB, - NG1791 sopA,parA, - NG1790 pdxA, - NG1786 R.NgoII, - NG1794.1 rnhB, - NG1789 NG1793 yaaJ, - NG1787 gidA, - NG1788 NG1792 gidB, - NG1791 sopA,parA, - NG1790 pdxA, - NG1786 R.NgoII, - NG1794.1 rnhB, - NG1789 NG1793 yaaJ, - NG1787 gidA, - NG1788 NG1792 gidB, - NG1791 sopA,parA, - NG1790 pdxA, - NG1786 rnhB, - NG1789 NG1793 yaaJ, - NG1787 gidA, - NG1788 R.NgoPII, - NG1794 R.NgoII, - NG1794.1 R.NgoPII, - NG1794
* Calculated from Protein Sequence

Gene ID: NG1789

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rnhB  

Definition:
ribonuclease HII

Gene Start:
1761880

Gene Stop:
1762515

Gene Length:
636

Molecular Weight*:
23268

pI*:
10.10

Net Charge*:
5.93

EC:
3.1.26.4  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table

Secondary Evidence:
Itaya,M.
Isolation and characterization of a second RNase H (RNase HII) of
Escherichia coli K-12 encoded by the rnhB gene
Proc. Natl. Acad. Sci. U.S.A. 87 (21), 8587-8591 (1990)
Medline: 91046040

Ohtani,N., Haruki,M., Morikawa,M., Crouch,R.J., Itaya,M. and
Kanaya,S.
Identification of the genes encoding Mn2+-dependent RNase HII and
Mg2+-dependent RNase HIII from Bacillus subtilis: classification of RNases H into three families
Biochemistry 38 (2), 605-618 (1999)
Medline: 99105810


Comment:
For other 'rnh' genes see NG1162 (rnh).

Oklahoma ID: NGO.1789

Blast Summary:  PSI-Blast Search
Residues 19-212 are 95% similar to ribonuclease HII from Neisseria meningitidis group A strain Z2491 (7378848|).

Numerous hits in gapped BLAST to ribonuclease HII sequences,e.g. residues 22-208 are 59% similar to ribonuclease HII from Haemophilus influenzae strain Rd KW20 (gb|AAC22714.1|).Residues 22-206 are 61% similar to ribonuclease HII from Escherichia coli (4902924|).Residues 17-206 are 57% similar to ribonuclease HII from Pseudomonas aeruginosa strain PAO1 (gb|AAG07030.1|).Residues 24-203 are 45% similar to ribonuclease HII from Chlamydia trachomatis serotype D,strain UW3/Cx (gb|AAC67619.1|).Residues 44-202 are 44% similar to ribonuclease HII from Porphyromonas gingivalis (1296968|).

COGS Summary:  COGS Search
BeTs to 15 clades of COG0164
COG name: Ribonuclease HII
Functional Class:  L
The phylogenetic pattern of COG0164 is amtkyqvcebrhuj--o-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 22-92 are 59% similar to a (RIBONUCLEASE HII PROTEIN RNASE) protein domain (PD003015) which is seen in RNH2_ECOLI.

Residues 94-202 are 60% similar to a (RIBONUCLEASE HII RNASE HYDROLASE) protein domain (PD005501) which is seen in RNH2_HAEIN.



Paralogs:  Local Blast Search


NG1789 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 24 to 202 (E-value = 5.1e-78) place NG1789 in the RNase_HII family which is described as Ribonuclease HII (PF01351)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
33  
49

PDB Hit:
pdb|1IO2|1IO2-A CRYSTAL STRUCTURE OF TYPE 2 RIBONUCLEASE H FROM 66.0 6e-12
pdb|1I39|1I39-A RNASE HII FROM ARCHAEOGLOBUS FULGIDUS 62.8 5e-11
pdb|1EKE|1EKE-A CRYSTAL STRUCTURE OF CLASS II RIBONUCLEASE H 43.4 3e-05
pdb|1IO2|1IO2-A CRYS

Gene Protein Sequence:
MPSETIFRRHRTIPTGNIMHILTAGVDEAGRGPLVGSVFAAAVILPETFD
LPGLTDSKKLSEKKRDALAEMIKEQAVAWHVAASTPEEIASLNILHATML
AMKRAVYGLAARPEKIFIDGNRIPEHLGIPAEAVVKGDSKIIEISAASVL
AKTARDAEMYALAQRRPQYGFDKHKGYGTKQHLEALKQYGVLPEHRRDFA
PVRNLLAQQALF

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGTCTGAAACCATTTTCAGACGGCATCGTACCATCCCGACAGGAAA
CATCATGCACATACTGACCGCCGGCGTGGACGAGGCAGGACGCGGACCTT
TGGTCGGCAGCGTGTTTGCCGCCGCCGTCATCCTTCCGGAAACATTCGAC
CTGCCCGGACTGACCGACTCCAAAAAACTCAGCGAGAAAAAACGCGACGC
GCTTGCCGAAATGATTAAAGAACAGGCGGTCGCGTGGCACGTCGCCGCCT
CCACGCCCGAAGAAATCGCAAGCCTCAACATCCTGCACGCCACCATGCTC
GCCATGAAACGTGCCGTTTACGGTTTGGCTGCGCGTCCCGAAAAAATATT
CATCGACGGCAACCGCATTCCCGAACATTTAGGCATCCCTGCCGAAGCAG
TCGTCAAAGGCGACAGCAAAATCATCGAAATCTCCGCCGCATCCGTTTTG
GCAAAGACCGCACGCGATGCGGAAATGTACGCACTGGCGCAACGCCGTCC
CCAATACGGTTTCGACAAACACAAAGGTTACGGCACAAAGCAGCATCTGG
AAGCCCTCAAACAATACGGCGTGCTGCCCGAACACCGCCGCGACTTCGCC
CCCGTCAGAAACCTGCTCGCGCAGCAGGCCTTGTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy