Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1454.1 IGR1456 IGR1457 IGR1459 IGR1455 IGR1460 IGR1458 IGR1454 NG1781.1 NG1784 pdxA, - NG1786 yceC,rluC, - NG1783 lpxB, - NG1782 dapB, - NG1781 yaaJ, - NG1787 gidA, - NG1788 rne, - NG1785 NG1781.1 NG1784 pdxA, - NG1786 yceC,rluC, - NG1783 lpxB, - NG1782 dapB, - NG1781 yaaJ, - NG1787 gidA, - NG1788 rne, - NG1785 NG1781.1 NG1784 pdxA, - NG1786 yceC,rluC, - NG1783 lpxB, - NG1782 dapB, - NG1781 yaaJ, - NG1787 gidA, - NG1788 rne, - NG1785
* Calculated from Protein Sequence

Gene ID: NG1785

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rne  

Definition:
ribonuclease E

Gene Start:
1754231

Gene Stop:
1756987

Gene Length:
2757

Molecular Weight*:
101662

pI*:
6.70

Net Charge*:
-2.61

EC:
3.1.4.-  

Functional Class:
Transcription; Degradation of RNA  
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminosugars metabolism

Secondary Evidence:
Chauhan,A.K., Miczak,A., Taraseviciene,L. and Apirion,D.
Sequencing and expression of the rne gene of Escherichia coli
Nucleic Acids Res. 19 (1), 125-129 (1991)
Medline: 91187608

Mohanty BK, Kushner SR.
Polyadenylation of Escherichia coli transcripts plays an integral role in regulating intracellular levels of polynucleotide phosphorylase and RNase E.
Mol Microbiol. 2002 Sep;45(5):1315-24.
PMID: 12207699

Leroy A, Vanzo NF, Sousa S, Dreyfus M, Carpousis AJ.
Function in Escherichia coli of the non-catalytic part of RNase E: role in the degradation of ribosome-free mRNA.
Mol Microbiol. 2002 Sep;45(5):1231-43.
PMID: 12207692

Ow MC, Kushner SR.
Initiation of tRNA maturation by RNase E is essential for cell viability in E. coli.
Genes Dev. 2002 May 1;16(9):1102-15.
PMID: 12000793

Lee K, Bernstein JA, Cohen SN.
RNase G complementation of rne null mutation identifies functional interrelationships with RNase E in Escherichia coli.
Mol Microbiol. 2002 Mar;43(6):1445-56.
PMID: 11952897

Tock MR, Walsh AP, Carroll G, McDowall KJ.
The CafA protein required for the 5'-maturation of 16 S rRNA is a 5'-end-dependent ribonuclease that has context-dependent broad
sequence specificity.
J Biol Chem. 2000 Mar 24;275(12):8726-32.
PMID: 10722715


Comment:
The cafA protein, also know as RNAse G, appears to Be NG0113.

Oklahoma ID: NGO.1785

Blast Summary:  PSI-Blast Search
Residues 1-919 are 83% similar to ribonuclease E from Neisseria
meningitidis group A strain Z2491 (11354133|).

Numerous hits in gapped BLAST to ribonuclease E sequences,e.g residues 1-563 are 56% similar to ribonuclease E from Xylella fastidiosa strain 9a5c (gb|AAF85404.1|).Residues 1-574 are 58% similar to ribonuclease E from Pseudomonas aeruginosa strain
PAO1 (gb|AAG06364.1|).Residues 1-524 are 60% similar to RNase E from Escherichia coli O157:H7 (gb|AAG55830.1|).Significant hits in gapped BLAST to axial filament protein sequences,e.g residues 10-481 are 33% similar to an axial filament protein from Chlamydia trachomatis serotype D,strain UW3/Cx (gb|AAC68404.1|).Residues 4-424 are 37% similar to cytosolic axial filament protein from Escherichia coli K12 and Escherichia coli O157:H7 (gb|AAG58374.1|).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1530
COG name: Ribonucleases G and E
Functional Class:  J
The phylogenetic pattern of COG1530 is ---k-qvcE-rH------inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 396-486 are 53% similar to a (RIBONUCLEASE E RNASE HYDROLASE) protein domain (PD042869) which is seen in RNE_ECOLI.

Residues 12-395 are 64% similar to a (PROTEIN RIBONUCLEASE E AXIAL) protein domain (PD007819) which is seen in RNE_HAEIN.



Paralogs:  Local Blast Search


NG1785 is paralogously related to NG0113 (cytoplasmic axial filament protein; RNAse G) (6e-70), NG1286 (translation initiation factor IF-2) (9e-07), NG0275 (IgA protease precursor (IgA-specific metalloendopeptidase precursor) (IgA-specific serine endopeptidase precursor)) (9e-07) and NG0265 (tetrapac protein) (3e-06).


Pfam Summary:  Pfam Search
Residues 35 to 117 (E-value = 1.7e-13) place NG1785 in the S1 family which is described as S1 RNA binding domain (PF00575)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
486  
919

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKRMLFNATQAEELRVAIVDGQNLLDLDIETLGKEQRKGNIYKGIITRIE
PSLEACFVDYGTDRHGFLPFKEVSRSYFLGYEGGRARIQDVLKEGMEVIV
QVEKDERGNKGAALTTFISLAGRYLVLMPNNPRGGGVSRRIEGEERQELK
AAMAQLDIPNGMSIIARTAGIGRSAEELEWDLNYLKQLWQAIEEAGKAHH
DPYLLFMESSLLIRAIRDYFRPDIGEILVDNQEVYDQVAEFMSYVMPGNA
GRLKLYEDHTPLFSRFQIEHQIESAFSRSVSLPSGGAIVIDHTEALVSID
VNSARATRGADIEDTAFKTNMEAAEEVARQMRLRDLGGLVVIDFIDMENP
KHQRDVENVLRDALKKDRARVQMGKLSRFGLLELSRQRLKPALGESSHAA
CPRCAGTGVIRGIESTALHVLRMVQEEAMKDNTGEVRAQVPVDVATFLLN
EKRAELFAMEERLDVNVVLIPNIHLENPHYEINRIRTDDVEEDGEPSYKR
VAEPEEDESAKPFGGEKAKAARPEPAVKGVRHTSPAPTAAPEKKTSWWDS
FKAWLKRIFGGSETQAVPAAETSEKRSTANRSGSRANNRRQNPRRSKREG
SKIEVREAAGKTAGQKARADKAETRNNGNRRRNERGDRATERANEAEIQS
RNVQPAAPVADAAPPETEGQTGKRRRNGSRNERGQTAPETAAVAETAVQT
AENTPPEPYTAEDKGSKPKSERNRRERDSRDAKERRERNNQRDRRQNGKK
RNIPSAAKIEQYLNIHDTADKVRSAAAHVFGETDANAPITVSIADPLIAT
PVQTASSAVSNGDALIYDAAEKIRRAAADILPEGAAPKAAAQEMPSETAT
FTAAAEQARETAQTGGLVLIETDPAALKAWAAQPEVQAGRGLRRSEQPKP
SEAATVPAEEMIQVETRQG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGAATGTTATTCAACGCAACGCAGGCCGAAGAGCTGCGCGTTGC
CATCGTCGACGGACAAAACCTGCTGGATTTGGACATCGAAACGCTGGGCA
AAGAACAGCGCAAAGGCAATATCTACAAAGGCATCATTACCCGCATCGAG
CCGTCGCTGGAAGCGTGTTTCGTCGATTACGGAACCGACCGCCACGGCTT
TTTGCCGTTTAAAGAAGTATCGCGTTCGTATTTCCTCGGCTACGAAGGCG
GGCGCGCGCGCATTCAGGACGTGCTCAAAGAAGGCATGGAAGTCATCGTC
CAAGTCGAAAAAGACGAGCGCGGCAACAAAGGCGCGGCGCTGACCACCTT
CATCAGCCTCGCCGGACGCTATCTGGTATTGATGCCGAACAATCCGCGCG
GCGGCGGCGTATCCCGCCGTATCGAAGGCGAAGAGCGTCAAGAACTCAAA
GCCGCGATGGCGCAACTCGACATTCCGAACGGCATGAGCATCATCGCGCG
TACCGCCGGCATCGGCCGCAGCGCGGAAGAGTTGGAATGGGATTTGAACT
ACCTCAAACAACTCTGGCAGGCAATCGAAGAAGCAGGAAAAGCGCATCAC
GACCCCTACCTGCTCTTTATGGAAAGCTCGTTGCTCATCCGCGCCATCCG
CGACTACTTCCGTCCCGACATCGGCGAAATTTTGGTGGACAATCAAGAAG
TTTACGACCAAGTTGCCGAGTTCATGAGCTACGTCATGCCGGGCAACGCA
GGTCGTCTGAAACTCTACGAAGACCACACGCCGCTGTTTTCCCGCTTCCA
AATCGAACACCAGATCGAAAGCGCGTTCTCGCGCAGCGTCAGCCTGCCCT
CCGGCGGCGCGATCGTCATCGACCACACCGAAGCCCTCGTCTCCATCGAC
GTGAACTCCGCACGCGCCACACGCGGCGCGGACATCGAAGACACCGCCTT
CAAAACCAATATGGAAGCTGCCGAAGAAGTCGCCCGACAAATGCGCCTGC
GCGACTTGGGCGGCTTGGTCGTCATCGACTTCATCGACATGGAAAACCCC
AAACACCAGCGCGATGTGGAAAACGTCCTGCGCGACGCACTCAAAAAAGA
CCGCGCCCGCGTACAGATGGGCAAACTCTCCCGTTTCGGACTTTTGGAAT
TGAGCCGCCAACGCCTGAAACCCGCTTTGGGCGAAAGCAGCCACGCCGCC
TGTCCGCGCTGCGCCGGCACCGGCGTGATCCGCGGCATCGAATCCACCGC
CCTGCACGTTTTGCGCATGGTTCAGGAAGAAGCGATGAAGGACAACACCG
GCGAAGTGCGCGCCCAAGTGCCCGTCGATGTCGCCACCTTCCTGCTGAAC
GAAAAACGCGCCGAGCTGTTTGCAATGGAAGAGCGTTTGGATGTGAACGT
CGTCCTGATTCCGAACATCCACCTCGAAAATCCGCACTACGAAATCAACC
GCATCCGCACCGACGACGTAGAAGAAGACGGCGAACCGAGCTACAAGCGC
GTTGCCGAGCCTGAAGAAGACGAATCCGCCAAACCTTTCGGCGGCGAAAA
AGCCAAAGCCGCCCGCCCCGAACCCGCCGTCAAAGGCGTGCGCCACACCA
GCCCCGCCCCGACTGCCGCCCCCGAGAAAAAAACCTCCTGGTGGGACAGC
TTCAAAGCATGGCTCAAACGCATTTTCGGCGGCAGCGAAACCCAAGCCGT
ACCCGCTGCCGAAACCTCCGAAAAACGCAGCACGGCAAACCGCAGCGGCA
GCCGCGCCAACAACCGCCGCCAAAACCCGCGCCGCAGCAAACGCGAAGGC
AGCAAAATAGAAGTCCGCGAAGCGGCGGGCAAAACTGCCGGACAGAAAGC
GCGCGCCGACAAAGCCGAAACGCGCAACAACGGCAACCGCCGCCGCAACG
AACGCGGCGACCGTGCCACCGAACGCGCCAACGAAGCGGAAATCCAAAGC
CGCAACGTACAGCCTGCCGCACCCGTTGCAGATGCCGCACCGCCCGAAAC
CGAAGGTCAAACCGGAAAACGCCGCCGCAACGGCAGCCGCAACGAACGTG
GCCAAACCGCACCGGAAACCGCCGCCGTTGCCGAAACAGCCGTTCAGACA
GCGGAAAACACGCCGCCCGAACCGTATACCGCAGAAGACAAAGGCAGCAA
GCCCAAATCCGAACGCAACCGCCGCGAACGCGACAGCCGCGATGCCAAAG
AACGCCGCGAACGCAACAATCAGCGCGACCGCCGTCAAAACGGCAAAAAA
CGCAATATCCCGTCTGCCGCCAAAATCGAGCAGTACCTGAATATTCACGA
CACCGCCGACAAAGTCCGTTCCGCCGCCGCGCACGTTTTCGGCGAAACCG
ACGCAAACGCGCCGATTACCGTCAGCATTGCCGATCCGCTCATCGCCACA
CCCGTTCAGACGGCATCTTCCGCCGTTTCAAACGGCGACGCACTGATTTA
TGATGCGGCGGAAAAAATCCGCCGTGCCGCCGCCGACATCCTGCCCGAAG
GCGCGGCACCGAAAGCCGCAGCACAGGAAATGCCGTCTGAAACCGCAACC
TTTACGGCTGCGGCGGAACAGGCACGGGAAACCGCACAAACCGGCGGACT
CGTCCTGATCGAAACCGACCCTGCCGCATTGAAGGCATGGGCGGCACAAC
CCGAAGTCCAAGCCGGACGCGGTTTGCGCCGTTCCGAACAGCCAAAACCG
TCTGAAGCCGCAACCGTCCCTGCCGAAGAAATGATCCAAGTCGAAACCCG
GCAAGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy