Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1454.1 IGR1453 IGR1451 IGR1456 IGR1457 IGR1459 IGR1455 IGR1452 IGR1458 IGR1454 NG1781.1 NG1784 fur, - NG1779 aat, - NG1778 pdxA, - NG1786 yceC,rluC, - NG1783 lpxB, - NG1782 omlA, - NG1780 dapB, - NG1781 rne, - NG1785 NG1781.1 NG1784 fur, - NG1779 aat, - NG1778 pdxA, - NG1786 yceC,rluC, - NG1783 lpxB, - NG1782 omlA, - NG1780 dapB, - NG1781 rne, - NG1785 NG1781.1 NG1784 fur, - NG1779 aat, - NG1778 pdxA, - NG1786 yceC,rluC, - NG1783 lpxB, - NG1782 omlA, - NG1780 dapB, - NG1781 rne, - NG1785
* Calculated from Protein Sequence

Gene ID: NG1783

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yceC  rluC  

Definition:
pseudouridylate synthase

Gene Start:
1753738

Gene Stop:
1752749

Gene Length:
990

Molecular Weight*:
36649

pI*:
10.70

Net Charge*:
20.77

EC:
4.2.1.70  

Functional Class:
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Conrad,J., Sun,D., Englund,N. and Ofengand,J.
The rluC gene of Escherichia coli codes for a pseudouridine
synthase that is solely responsible for synthesis of pseudouridine
at positions 955, 2504, and 2580 in 23 S ribosomal RNA
J. Biol. Chem. 273 (29), 18562-18566 (1998)
Medline: 98325071


Comment:
For other 'rlu' genes see NG0278 (rluD).

Oklahoma ID: NGO.1783c

Blast Summary:  PSI-Blast Search
No hits to Neisseria gonorrhoeae found.

Numerous hits in gapped BLAST to pseudouridylate synthase sequences,e.g. residues 1-330 are 93% similar to the enzyme pseudouridylate synthase from Neisseria meningitidis group A strain Z2491 (emb|CAB83386.1|)

Residues 10-316 are 49% similar to the hypothetical protein Escherichia coli O157:H7 EDL933 (gb|AAG55832.1|)

Residues 93-314 are 34% similar to the conserved hypothetical protein TP0231 of syphilis spirochete Treponema pallidum (gb|AAC65220.1|)

Residues 16-317 are 27% similar to Pseudouridine Synthase of Chlamydia trachomatis (gb|AAC68253.1|)

COGS Summary:  COGS Search
BeTs to 13 clades of COG0564
COG name: Predicted pseudouridylate synthase family 2
Functional Class:  J
The phylogenetic pattern of COG0564 is ----YqVCEBRHUJGPOLINX
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB000613 (Pseudouridine synthase) with a combined E-value of 4.1e-56.
    IPB000613A    96-116
    IPB000613B    141-180
    IPB000613C    249-273
    IPB000613D    288-301
***** IPB002990 (Pseudouridine synthase, Rlu family) with a combined E-value of 6.4e-51.
    IPB002990A    96-116
    IPB002990B    141-179
    IPB002990C    249-273


ProDom Summary:  Protein Domain Search
Residues 96-316 are 47% similar to a (PROTEIN PSEUDOURIDINE SYNTHASE RIBOSOMAL) protein domain (PD001819) which is seen in RLUC_ECOLI.

Residues 10-79 are 61% similar to a (RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE) protein domain (PD037655) which is seen in RLUC_HAEIN.



Paralogs:  Local Blast Search


NG1783 is paralogously related to NG0278 (ribosomal large subunit pseudouridine synthase D (probable ftsH suppressor protein SfhB)) (5e-32), NG0433 (conserved hypothetical protein (probable pseudouridine synthase)) (3e-11) and NG1180 (conserved hypothetical protein) (3e-08).


Pfam Summary:  Pfam Search
Residues 23 to 69 (E-value = 5e-08) place NG1783 in the S4 family which is described as S4 domain (PF01479)
Residues 102 to 261 (E-value = 2.8e-40) place NG1783 in the PseudoU_synth_2 family which is described as RNA pseudouridylate synthase (PF00849)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
15

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKTHEISKGSVSLIGVAEHEAGQRLDNYLIKILKGVPKGYIHRIIRAGEV
RLNKKRCKPDSRIAEGDTVRIPPVRVAEKEMPSERRAAVPARAFEVVYED
DALLVVNKPSGVAVHGGSGVSFGVIEQLRRARPEAKYLELVHRLDKDTSG
LLMVAKKRSALVKLHEAIRNDHPKKIYLALGVGKLPDDNFHVKLPLFKYT
GAQGEKMVRVSEDGQSAHTVFRVLSRFSDGILHGVGLSHLTLVRATLKTG
RTHQIRVHLQSQGCPIAGDERYGDYQANRRLQKLGLKRMFLHASELHLNH
PLTGEPLVLKAEPPPDLAQFAVMLENGTKM

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACGCACGAAATAAGCAAAGGTTCGGTCAGCCTGATAGGGGTTGC
CGAACATGAGGCGGGTCAACGCCTTGATAACTATCTGATAAAAATCCTCA
AGGGCGTGCCCAAGGGCTATATCCACCGCATTATCCGCGCCGGCGAGGTG
CGGTTGAACAAGAAACGCTGCAAACCCGACAGCCGTATTGCGGAGGGAGA
TACGGTGCGGATTCCGCCTGTGCGCGTGGCGGAGAAGGAAATGCCGTCTG
AAAGGCGTGCCGCCGTACCGGCGCGTGCGTTTGAGGTGGTGTATGAGGAC
GACGCGCTACTGGTGGTCAATAAGCCTTCCGGTGTGGCGGTACACGGTGG
CAGCGGCGTGAGTTTCGGCGTTATCGAACAGTTGCGCCGCGCCCGTCCGG
AGGCGAAGTATTTGGAGTTGGTCCACCGTTTGGACAAGGATACGAGCGGC
TTGTTGATGGTGGCGAAGAAACGCAGCGCGCTCGTCAAACTGCACGAAGC
TATCCGTAACGACCACCCCAAAAAAATCTACCTTGCGCTGGGGGTGGGCA
AACTGCCGGACGACAATTTCCATGTCAAACTGCCCCTGTTCAAATATACC
GGCGCACAAGGCGAAAAGATGGTACGCGTCAGCGAGGACGGGCAGTCGGC
GCATACGGTGTTCCGTGTGTTAAGCCGTTTCTCAGACGGCATTTTGCACG
GTGTCGGGCTGTCGCACCTGACTTTGGTGCGGGCAACGCTGAAAACGGGC
CGTACGCACCAAATCCGCGTGCATCTGCAATCTCAAGGCTGTCCGATTGC
GGGCGACGAACGCTACGGCGATTATCAGGCGAACCGGCGTTTGCAGAAAT
TGGGTTTGAAGCGCATGTTTTTGCACGCGTCCGAGCTGCACCTGAACCAT
CCGCTCACGGGTGAGCCGCTGGTGTTGAAGGCGGAGCCGCCGCCGGATTT
GGCGCAGTTTGCGGTGATGTTGGAAAACGGGACGAAAATG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy