Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1454.1 IGR1453 IGR1449 IGR1450 IGR1451 IGR1456 IGR1457 IGR1455 IGR1452 IGR1458 IGR1454 NG1781.1 NG1784 fur, - NG1779 aat, - NG1778 yceC,rluC, - NG1783 lpxB, - NG1782 NG1777 omlA, - NG1780 dapB, - NG1781 gapB,gapA, - NG1776 rne, - NG1785 NG1781.1 NG1784 fur, - NG1779 aat, - NG1778 yceC,rluC, - NG1783 lpxB, - NG1782 NG1777 omlA, - NG1780 dapB, - NG1781 gapB,gapA, - NG1776 rne, - NG1785 NG1781.1 NG1784 fur, - NG1779 aat, - NG1778 yceC,rluC, - NG1783 lpxB, - NG1782 NG1777 omlA, - NG1780 dapB, - NG1781 gapB,gapA, - NG1776 rne, - NG1785
* Calculated from Protein Sequence

Gene ID: NG1782

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lpxB  

Definition:
lipid-A-disaccharide synthase

Gene Start:
1752577

Gene Stop:
1751426

Gene Length:
1152

Molecular Weight*:
42334

pI*:
8.90

Net Charge*:
6.48

EC:
2.4.1.182  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  
Central intermediary metabolism; Amino sugars  

Pathway: pathway table
Lipopolysaccharide biosynthesis

Secondary Evidence:
Servos,S.,Khan,S.and Maskell,D.
Cloning and expression of genes encoding lipid A biosynthesis from
Haemophilus influenzae type b
Gene 175 (1-2), 137-141 (1996)
Medline: 97074663

Crowell,D.N., Reznikoff,W.S. and Raetz,C.R.
Nucleotide sequence of the Escherichia coli gene for lipid A disaccharide synthase
J. Bacteriol. 169 (12), 5727-5734 (1987)
Medline: 88058790

Coleman,J. and Raetz,C.R.
First committed step of lipid A biosynthesis in Escherichia coli:
sequence of the lpxA gene
J. Bacteriol. 170 (3), 1268-1274 (1988)
Medline: 88139188



Comment:
For other 'lpx' genes see NG0242 (lpxK),NG1806 (lpxA), NG1803
(lpxD)and NG2065 (lpxC).

Oklahoma ID: NGO.1782c

Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to lipid-A-disaccharide synthase
sequences, e.g. residues 1-384 are 84% similar to the enzyme lipid-A-disaccharide synthase from Neisseria meningitidis MC58 (gb|AAF40656.1|)

Residues 9-330 are 45% similar to the enzyme lipid-A-disaccharide synthase from Pseudomonas aeruginosa (gb|AAG07031.1|)Residues 11-329 are 28% similar to the enzyme lipid-A-disaccharide synthase from Chlamydia trachomatis (gb|AAC68008.1|).Residues 1-330 are 42% similar to the enzyme lipid-A-disaccharide synthase from Escherichia coli O157:H7 (gb|AAG54484.1|)

COGS Summary:  COGS Search
BeTs to 6 clades of COG0763
COG name: Lipid A disaccharide synthetase
Functional Class:  M
The phylogenetic pattern of COG0763 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003835 (Lipid-A-disaccharide synthetase) with a combined E-value of 6.6e-41.
    IPB003835A    20-74
    IPB003835B    116-132


ProDom Summary:  Protein Domain Search
Residues 7-330 are 44% similar to a (SYNTHASE LIPID A LIPID-A-DISACCHARIDE) protein domain (PD014237) which is seen in LPXB_HAEIN.



Paralogs:  Local Blast Search


NG1782 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 378 (E-value = 6.7e-113) place NG1782 in the LpxB family which is described as Lipid-A-disaccharide synthetase (PF02684)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
37  
116
non-globular  
185  
384

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MVDKKSPLIAVSVGEASGDLLGAHLIRAIRKRCPQARLTGIGGELMKAEG
FESLYDQERLAVRGFVEVVRRLPEILRIRRELVRDLLSLKPDVFVGIDAP
DFNLGVAEKLKRAGIPTLHYVSPSVWAWRRERVGKIVHQVNRVLCLFPME
PQLYLDAGGRAEFVGHPMAQLMPLEDDRETARKTLGADVGIPVFALLPGS
RVSEIDYMAPVFFQTALLLLERYPAARFLLPAATEATKRRLAEVLQRPEF
AGLALTVTDRQSETVCRAADAVLVTSGTATLEVALCKRPMVISYKISPLT
YAYVKRKIKVPHVGLPNILLGKEAVPELLQSEAKPEKLAAALADWYEHPD
KVAALQQDFGALHLLLKKDTADLAARAVLEEAGC

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTGATAAAAAAAGCCCTTTGATTGCCGTCAGTGTCGGCGAAGCGTC
GGGCGACCTGTTGGGGGCGCACCTGATACGCGCCATCCGAAAGCGTTGCC
CGCAGGCACGGTTAACCGGCATCGGCGGGGAACTGATGAAGGCGGAAGGT
TTCGAGAGCCTTTATGATCAGGAGCGGCTGGCGGTGCGCGGCTTTGTCGA
AGTGGTCAGGCGGCTGCCGGAAATTTTACGGATACGCAGGGAGCTGGTAC
GGGATTTGCTGTCGTTGAAACCTGATGTCTTTGTCGGTATCGATGCGCCC
GATTTTAATCTGGGTGTGGCGGAAAAGCTGAAACGGGCGGGCATTCCGAC
CCTGCATTATGTCAGTCCGTCGGTTTGGGCGTGGCGGCGCGAACGCGTGG
GCAAAATCGTGCATCAGGTCAACCGCGTGCTGTGCCTGTTCCCGATGGAG
CCGCAGCTTTATCTCGATGCGGGCGGACGTGCGGAGTTTGTCGGTCATCC
GATGGCACAGCTTATGCCCTTGGAAGACGACCGTGAAACGGCGCGGAAAA
CTTTGGGCGCGGATGTCGGCATCCCCGTATTCGCCCTGCTGCCCGGCAGC
CGCGTCAGCGAAATCGACTATATGGCGCCGGTGTTTTTTCAGACGGCATT
ATTGTTGTTGGAACGCTATCCCGCCGCCCGCTTCCTGCTGCCTGCCGCAA
CGGAGGCGACGAAGCGGCGTTTGGCGGAAGTTTTGCAGCGGCCGGAGTTT
GCCGGATTGGCGCTGACGGTAACCGACAGACAGTCTGAAACGGTGTGCAG
GGCGGCGGATGCGGTGCTGGTAACGAGCGGTACGGCGACTTTGGAGGTGG
CGTTGTGCAAGCGTCCGATGGTCATCAGCTACAAGATTTCGCCGCTGACC
TATGCTTATGTGAAACGCAAAATCAAAGTGCCGCATGTCGGCCTGCCGAA
TATCCTGTTGGGTAAGGAGGCCGTGCCGGAATTATTGCAATCTGAAGCAA
AACCGGAAAAACTGGCGGCGGCATTGGCGGACTGGTACGAACACCCCGAT
AAGGTTGCCGCGCTGCAACAGGATTTCGGGGCGTTGCACCTGCTGTTGAA
AAAAGATACGGCGGATTTGGCCGCGCGCGCGGTTTTGGAAGAGGCGGGAT
GT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy