Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1454.1 IGR1453 IGR1449 IGR1450 IGR1451 IGR1456 IGR1457 IGR1447 IGR1455 IGR1448 IGR1452 IGR1454 NG1781.1 NG1784 fur, - NG1779 aat, - NG1778 yceC,rluC, - NG1783 lpxB, - NG1782 kefB,kefC, - NG1774 NG1777 omlA, - NG1780 dapB, - NG1781 NG1775 gapB,gapA, - NG1776 rne, - NG1785 NG1781.1 NG1784 fur, - NG1779 aat, - NG1778 yceC,rluC, - NG1783 lpxB, - NG1782 kefB,kefC, - NG1774 NG1777 omlA, - NG1780 dapB, - NG1781 NG1775 gapB,gapA, - NG1776 rne, - NG1785 NG1781.1 NG1784 fur, - NG1779 aat, - NG1778 yceC,rluC, - NG1783 lpxB, - NG1782 kefB,kefC, - NG1774 NG1777 omlA, - NG1780 dapB, - NG1781 NG1775 gapB,gapA, - NG1776 rne, - NG1785
* Calculated from Protein Sequence

Gene ID: NG1781

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dapB  

Definition:
dihydrodipicolinate reductase

Gene Start:
1749974

Gene Stop:
1750780

Gene Length:
807

Molecular Weight*:
28255

pI*:
6.30

Net Charge*:
-3.68

EC:
1.3.1.26  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Lysine biosynthesis

Secondary Evidence:
Bouvier,J.,Richaud,C.,Richaud,F.,Patte,J.C. and Stragier,P.
Nucleotide sequence and expression of the Escherichia coli dapB
gene.
J.Biol.Chem. 259(23),14829-14834(1984)
Medline: 85054974

Kwon,D.H.,Lu,C.D.,Walthall,D.A.,Brown,T.M.,Houghton,J.E.and Abdelal,A.T.
Structure and regulation of the carAB operon in Pseudomonas
aeruginosa and Pseudomonas stutzeri: no untranslated region exists
J. Bacteriol. 176(9),2532-2542(1994)
Medline: 94222830


Comment:
See also: dapA, NG0947; dapD, NG1667; dapE, NG0991; dapF, NG0338.

Oklahoma ID: NGO.1781

Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to dihydrodipicolinate reductase
sequences,e.g. residues 1-269 are 95% similar to the enzyme dihydrodipicolinate reductase from Neisseria meningitidis group B strain MD58 (gb|AAF40660.1|)

Residues 4-268 are 59% similar to the enzyme dihydrodipicolinate reductase from Escherichia coli O157:H7 EDL933 (gb|AAG54333.1|). Residues 6-245 are 27% similar to to the enzyme dihydrodipicolinate reductase from Chlamydia trachomatis (gb|AAC67960.1|).


COGS Summary:  COGS Search
BeTs to 12 clades of COG0289
COG name: Dihydrodipicolinate reductase
Functional Class:  E
The phylogenetic pattern of COG0289 is amt--qvcebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000846 (Dihydrodipicolinate reductase) with a combined E-value of 6.1e-76.
    IPB000846A    5-16
    IPB000846B    71-103
    IPB000846C    118-133
    IPB000846D    149-168
    IPB000846E    207-244


ProDom Summary:  Protein Domain Search
Residues 198-265 are 81% similar to a (DIHYDRODIPICOLINATE REDUCTASE) protein domain (PD008377) which is seen in DAPB_PSESZ.

Residues 4-193 are 53% similar to a (DIHYDRODIPICOLINATE REDUCTASE) protein domain (PD004105) which is seen in DAPB_HAEIN.



Paralogs:  Local Blast Search


NG1781 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 126 (E-value = 5.2e-53) place NG1781 in the DapB_N family which is described as Dihydrodipicolinate reductase, N-terminus (PF01113)
Residues 129 to 265 (E-value = 8.2e-81) place NG1781 in the DapB_C family which is described as Dihydrodipicolinate reductase, C-terminus (PF05173)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
75

PDB Hit:
pdb|1ARZ|1ARZ-A ESCHERICHIA COLI DIHYDRODIPICOLINATE REDUCTASE 308.0 7e-85

Gene Protein Sequence:
MIPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYA
VGLKTGIAISDDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGT
TGFDDAGKAAIRAAAEKTGIVFAANFSVGVNLTFHILDTVARVLNEGYDI
EIIEGHHRHKVDAPSGTALRMGEVIAGALGRDLKQCAVYGREGHTGPRDP
STIGFATVRAGDIVGDHTALFATDGERVEITHKAGSRMTFAAGAVRAAVW
VNGKTGLYDMQDVLGLNNR

Gene Nucleotide Sequence:  Sequence Viewer
ATGATACCGCTCAAAATCGCCATCGCCGGCGCAAACGGCCGCATGGGACG
CGTCCTCGTCGAAGCCGTCAACAACCATCCCGACACCGTCCTTTCCGGCG
CGCTCGAACACTCAGGCTCAGAAGCCCTCGGGCTGGACGCGGGCTACGCC
GTCGGACTCAAAACCGGCATCGCCATTTCAGACGACGTTGACGCCGTTCT
CGCCCAAAGCGACGTACTCATCGACTTCACCCGCCCCGAGCCGACCCTCA
AGCACCTGCAAAAATGCGTTGAAAAACAAGTCAACATCATCATCGGCACA
ACAGGCTTCGACGATGCGGGCAAAGCCGCCATCCGCGCCGCCGCCGAAAA
AACAGGCATCGTTTTCGCCGCCAACTTCAGCGTCGGCGTCAACCTCACCT
TCCACATCCTCGACACCGTCGCCCGCGTCCTCAACGAAGGCTACGACATC
GAAATCATCGAAGGCCACCACCGCCACAAAGTCGATGCCCCCAGCGGCAC
AGCATTACGAATGGGCGAAGTCATCGCCGGCGCGCTCGGCCGCGACCTCA
AACAATGCGCCGTTTACGGCCGCGAAGGCCACACTGGTCCGCGCGATCCT
TCCACCATCGGCTTTGCCACCGTCCGCGCAGGCGACATAGTCGGCGACCA
CACCGCCCTCTTCGCCACCGACGGCGAACGCGTGGAAATCACCCACAAAG
CCGGCAGCCGCATGACCTTTGCCGCCGGTGCCGTCCGCGCCGCAGTTTGG
GTAAACGGCAAAACGGGTTTGTACGATATGCAGGACGTACTCGGGCTGAA
CAACCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy