Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Val-3 tRNA-Asp-2 IGR1454.1 IGR1453 IGR1449 IGR1450 IGR1451 IGR1447 IGR1455 IGR1448 IGR1452 IGR1454 IGR1446 NG1781.1 fur, - NG1779 aat, - NG1778 yceC,rluC, - NG1783 lpxB, - NG1782 kefB,kefC, - NG1774 NG1777 omlA, - NG1780 dapB, - NG1781 NG1775 gapB,gapA, - NG1776 NG1781.1 fur, - NG1779 aat, - NG1778 yceC,rluC, - NG1783 lpxB, - NG1782 kefB,kefC, - NG1774 NG1777 omlA, - NG1780 dapB, - NG1781 NG1775 gapB,gapA, - NG1776 NG1781.1 fur, - NG1779 aat, - NG1778 yceC,rluC, - NG1783 lpxB, - NG1782 kefB,kefC, - NG1774 NG1777 omlA, - NG1780 dapB, - NG1781 NG1775 gapB,gapA, - NG1776
* Calculated from Protein Sequence

Gene ID: NG1778

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aat  

Definition:
leucyl/phenylalanyl-tRNA--protein transferase

Gene Start:
1748856

Gene Stop:
1748134

Gene Length:
723

Molecular Weight*:
26886

pI*:
6.80

Net Charge*:
-0.64

EC:
2.3.2.-  2.3.2.6  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  
Translation; Protein modification and translation factors  

Pathway: pathway table
Prostaglandin and leukotriene metabolism

Secondary Evidence:
Shrader,T.E., Tobias,J.W. and Varshavsky,A.
The N-end rule in Escherichia coli: cloning and analysis of the
leucyl, phenylalanyl-tRNA-protein transferase gene aat
J. Bacteriol. 175 (14), 4364-4374 (1993)
Medline: 93322314

Scarpulla RC, Soffer RL.
Regulation of proline dehydrogenase activity in Escherichia coli by leucyl-, phenylalanyl-tRNA:protein transferase.
J Biol Chem. 1979 Mar;254(5):1724-5.
PMID: 368074

Scarpulla RC, Deutch CE, Soffer RL.
Transfer of methionyl residues by leucyl, phenylalanyl-tRNA-protein transferase.
Biochem Biophys Res Commun. 1976 Jul;71(2):584-9.
PMID: 786290

Soffer RL, Savage M.
A mutant of Escherichia coli defective in leucyl, phenylalanyl-tRNA-protein transferase.
Proc Natl Acad Sci U S A. 1974 Mar;71(3):1004-7.
PMID: 4595564

Leibowitz MJ, Soffer RL.
Modification of a specific ribosomal protein catalyzed by leucyl, phenylalanyl-tRNA: protein transferase.
Proc Natl Acad Sci U S A. 1971 Aug;68(8):1866-9.
PMID: 4942916

Comment:
For other 'aat'genes see NG1047.


Oklahoma ID: NGO.1778c

Blast Summary:  PSI-Blast Search
Residues 1-241 are 92% similar to leucyl/phenylalanyl-tRNA--protein transferase from Neisseria meningitidis group B strain MD58 (gb|AAF40663.1|).

Significant hits in gapped BLAST to leucyl/phenylalanyl-tRNA--protein transferase sequences,e.g.residues 6-220 are 39% similar to leucyl/phenylalanyl-tRNA-protein transferase from Pseudomonas aeruginosa strain PAO1 (gb|AAG06005.1|).Residues 1-222 are 38% similar to leucyl, phenylalanyl-tRNA--protein transferase from Escherichia coli K12 (gb|AAC73971.1|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 39-219 are 38% similar to a (TRANSFERASE LEUCYL/PHENYLALANYL-TRNA--PROTEIN) protein domain (PD022844) which is seen in LPTP_ECOLI.



Paralogs:  Local Blast Search


NG1778 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 34 to 212 (E-value = 6.1e-118) place NG1778 in the Leu_Phe_trans family which is described as Leucyl/phenylalanyl-tRNA protein transferase (PF03588)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
176  
192

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MRIPLLAPDNYAFPDPAYALARCDGLVGVSRDLDAGRLLEAYRNGVFPWF
SRDGWFFWYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVA
HCAAAARPNQDGTWIAPEFQTAYLKLHEMGHAHSFECHYPDENGKTRLAG
GFYGVQIGRVFYGESMFALQPDASKIAFACAVPFLADLGVELIDCQQDTE
HMRRFGSELLPFADFAERLRMLNAVPLKEEIGRREVACKGL

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTATTCCGCTGCTTGCCCCTGACAATTATGCCTTTCCCGATCCTGC
CTATGCTTTGGCCCGGTGCGACGGGCTGGTCGGCGTGAGCAGGGATTTGG
ACGCGGGGCGGCTGCTCGAGGCGTATCGGAACGGCGTGTTTCCTTGGTTT
TCGCGGGACGGTTGGTTTTTTTGGTATGCGGTCGGGCCGCGTGCGGTAAT
TGTTCCCGAACGTCTGCACGTTCCGCGCTCGCTGGCGAAAACGCTGCGTA
ACGGCAGCTATCGGGTTGCGGTCAACGGCTGTTTTGCGGAAGTTGTCGCG
CATTGTGCGGCAGCGGCGCGCCCGAATCAGGATGGGACTTGGATTGCGCC
CGAGTTTCAGACGGCATATTTGAAGCTGCACGAAATGGGACACGCGCATT
CTTTCGAGTGCCATTATCCCGATGAAAACGGTAAAACGAGGTTGGCGGGC
GGCTTTTACGGCGTTCAGATCGGCAGGGTGTTTTATGGCGAATCGATGTT
TGCGTTGCAACCGGATGCGTCGAAAATCGCGTTTGCCTGCGCCGTGCCGT
TTTTGGCGGATTTGGGCGTGGAACTGATAGACTGCCAGCAGGATACGGAA
CATATGCGCCGTTTCGGTTCGGAGCTGCTGCCGTTTGCGGATTTTGCCGA
ACGTCTGCGGATGTTGAACGCCGTGCCGTTGAAAGAGGAAATCGGGCGGC
GCGAAGTGGCGTGCAAGGGGCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy