Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Val-3 tRNA-Val-2 tRNA-Asp-2 tRNA-Asp-1 IGR1454.1 IGR1453 IGR1449 IGR1450 IGR1451 IGR1447 IGR1448 IGR1452 IGR1454 IGR1446 NG1781.1 fur, - NG1779 aat, - NG1778 lpxB, - NG1782 kefB,kefC, - NG1774 NG1777 omlA, - NG1780 dapB, - NG1781 NG1775 gapB,gapA, - NG1776 sdaA,sdaB, - NG1773 NG1781.1 fur, - NG1779 aat, - NG1778 lpxB, - NG1782 kefB,kefC, - NG1774 NG1777 omlA, - NG1780 dapB, - NG1781 NG1775 gapB,gapA, - NG1776 sdaA,sdaB, - NG1773 NG1781.1 fur, - NG1779 aat, - NG1778 lpxB, - NG1782 kefB,kefC, - NG1774 NG1777 omlA, - NG1780 dapB, - NG1781 NG1775 gapB,gapA, - NG1776 sdaA,sdaB, - NG1773
* Calculated from Protein Sequence

Gene ID: NG1776

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gapB  gapA  

Definition:
glyceraldehyde 3-phosphate dehydrogenase

Gene Start:
1746845

Gene Stop:
1747873

Gene Length:
1029

Molecular Weight*:
36953

pI*:
6.70

Net Charge*:
-1.25

EC:
1.2.1.12  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
D-Arginine and D-ornithine metabolism
Glycolysis / Gluconeogenesis

Secondary Evidence:
Conway,T., Sewell,G.W. and Ingram,L.O.
Glyceraldehyde-3-phosphate dehydrogenase gene from Zymomonas
mobilis: Cloning, sequencing, and identification of promoter region
J. Bacteriol. 169, 5653-5662 (1987)
Medline: 88058780

Alefounder,P.R. and Perham,R.N.
Identification, molecular cloning and sequence analysis of a gene
cluster encoding the class II fructose 1,6-bisphosphate aldolase,
3-phosphoglycerate kinase and a putative second glyceraldehyde
3-phosphate dehydrogenase of Escherichia coli
Mol. Microbiol. 3 (6), 723-732 (1989)
Medline: 89313302

Zhao,G., Pease,A.J., Bharani,N. and Winkler,M.E.
Biochemical characterization of gapB-encoded erythrose 4-phosphate
dehydrogenase of Escherichia coli K-12 and its possible role in
pyridoxal 5'-phosphate biosynthesis
J. Bacteriol. 177 (10), 2804-2812 (1995)
Medline: 95270598



Comment:
For other 'gap'genes see NG1931 (gapC).


This protein could play a role in pyridoxal 5'-phosphate synthesis.

Oklahoma ID: NGO.1776

Blast Summary:  PSI-Blast Search
Residues 1-343 are 95% similar to glyceraldehyde 3-phosphate dehydrogenase from Neisseria meningitidis group B strain MD58 (gb|AAF40664.1|).

Numerous hits in gapped BLAST to glyceraldehyde 3-phosphate dehydrogenase sequences,e.g.residues 1-330 are 61% similar to glyceraldehyde-3-phosphate dehydrogenase from Pseudomonas aeruginosa strain PAO1 (gb|AAG06583.1|).Residues 1-334 are 44% similar to glyceraldehyde 3-phosphate dehydrogenase from Escherichia coli K12 (gb|AAA69094.1|).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0057
COG name: Glyceraldehyde-3-phosphate dehydrogenase
Functional Class:  G
The phylogenetic pattern of COG0057 is amtkYqvCEBrhUJgpolin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000173 (Glyceraldehyde 3-phosphate dehydrogenase) with a combined E-value of 2.4e-128.
    IPB000173A    4-15
    IPB000173B    92-128
    IPB000173C    149-183
    IPB000173D    186-239
    IPB000173E    254-307
    IPB000173F    310-330


ProDom Summary:  Protein Domain Search
Residues 45-119 are 69% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD GLYCERALDEHYDE) protein domain (PD000255) which is seen in G3PP_ALCEU.

Residues 256-331 are 67% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD GLYCERALDEHYDE) protein domain (PD000248) which is seen in G3PC_ALCEU.

Residues 120-159 are 77% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD GLYCERALDEHYDE) protein domain (PD000250) which is seen in G3PC_ALCEU.

Residues 160-254 are 71% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD GLYCERALDEHYDE) protein domain (PD000244) which is seen in G3P2_RHOSH.



Paralogs:  Local Blast Search


NG1776 is paralogously related to NG1931 (glyceraldehyde 3-phosphate dehydrogenase C (GapC)) (9e-86).


Pfam Summary:  Pfam Search
Residues 3 to 155 (E-value = 1.7e-85) place NG1776 in the Gp_dh_N family which is described as Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain (PF00044)
Residues 156 to 317 (E-value = 4.1e-95) place NG1776 in the Gp_dh_C family which is described as Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain (PF02800)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|3DBV|3DBV-O GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE MUTANT 351.0 8e-98
pdb|1DBV|1DBV-O GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE MUTANT 348.0 9e-97
pdb|1GD1|1GD1-O $HOLO-*D-*GLYCERALDEHYDE-3-PHOSPHATE 347.0 2e-96
pdb|1HDG|1HDG-O HOLO

Gene Protein Sequence:
MGIKVAINGYGRIGRQVLRAIYDYQIQDQLQIVAVNASGSLETNAHLTKF
DTVHGRFEADVSHDGGNLIVNGDKIPFFSTRNPAELPWKELGVDLVMECT
GAFTSKEKAKIHLESGAKKVLISAPGGDDVDATVVYGVNDSVLTADMTVV
SNASCTTNCLSPVAKVLSESVGIVKGAMTTIHALTNDQTVTDVRHKDLRR
ARSGVENMIPTKTGAAKAVGLVLPELKGRLDGLAIRVPTVNVSLVDLSFQ
AARDTTVEEINALMKAVSEAGALKGVLGYNTLPLVSMDFNHTTEASHFDA
TLTKVVDGNMVKVFAWYDNEWGFSCQMLNTARRMFGLEVRPLK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCATCAAAGTCGCCATCAACGGCTACGGACGCATCGGCCGCCAGGT
TTTGCGCGCCATCTACGACTATCAGATTCAAGACCAACTCCAAATCGTCG
CCGTCAACGCCAGCGGCAGCCTTGAAACCAACGCCCATCTGACCAAATTC
GACACCGTACACGGACGCTTTGAAGCCGACGTATCCCACGACGGCGGCAA
CCTCATCGTCAACGGCGACAAAATCCCCTTCTTCTCGACCCGCAACCCTG
CCGAACTGCCGTGGAAAGAACTCGGTGTCGATTTGGTCATGGAATGCACC
GGCGCGTTCACCAGCAAAGAAAAAGCCAAAATCCACCTCGAAAGCGGCGC
GAAAAAAGTCCTCATTTCCGCACCGGGCGGCGACGATGTCGATGCAACCG
TCGTGTACGGCGTGAACGACAGCGTCCTGACCGCCGACATGACCGTCGTT
TCCAACGCTTCCTGCACCACCAACTGCCTCTCGCCGGTTGCCAAAGTGTT
GAGCGAAAGCGTCGGCATCGTCAAAGGCGCAATGACCACCATCCACGCAC
TGACCAACGACCAAACCGTTACCGACGTGCGCCACAAAGACCTGCGCCGC
GCCCGCAGCGGCGTGGAAAACATGATTCCGACCAAAACCGGCGCGGCAAA
AGCCGTCGGTTTGGTCTTGCCCGAATTGAAAGGCAGACTCGACGGGCTTG
CCATCCGCGTGCCGACCGTCAACGTATCCTTGGTAGATTTGAGCTTCCAA
GCCGCGCGCGACACCACAGTCGAAGAAATCAACGCACTGATGAAAGCCGT
CTCGGAAGCAGGCGCGCTCAAAGGCGTTTTGGGCTACAACACCCTGCCAT
TGGTTTCCATGGACTTCAACCACACCACCGAAGCCAGCCACTTCGACGCA
ACGCTGACCAAAGTCGTCGACGGCAACATGGTCAAAGTGTTCGCGTGGTA
TGACAACGAATGGGGCTTCAGCTGCCAAATGCTGAACACCGCACGCCGTA
TGTTCGGACTTGAAGTGCGCCCGCTCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy