Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Val-3 tRNA-Val-2 tRNA-Asp-2 tRNA-Asp-1 IGR1443 IGR1445 IGR1447 IGR1444 IGR1448 IGR1446 NG1771 kefB,kefC, - NG1774 prlC, - NG1770 NG1775 sdaA,sdaB, - NG1773 gyrB, - NG1772 NG1771 kefB,kefC, - NG1774 prlC, - NG1770 NG1775 sdaA,sdaB, - NG1773 gyrB, - NG1772 NG1771 kefB,kefC, - NG1774 prlC, - NG1770 NG1775 sdaA,sdaB, - NG1773 gyrB, - NG1772
* Calculated from Protein Sequence

Gene ID: NG1773

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sdaA  sdaB  

Definition:
L-serine dehydratase; L-serine deaminase

Gene Start:
1741080

Gene Stop:
1742462

Gene Length:
1383

Molecular Weight*:
49175

pI*:
7.00

Net Charge*:
0.00

EC:
4.2.1.13  

Functional Class:
Energy metabolism; Amino acids and amines  

Pathway: pathway table
Cysteine metabolism
Glycine, serine and threonine metabolism

Secondary Evidence:
Reizer,J., Reizer,A., Merrick,M.J., Plunkett,G. III, Rose,D.J. and
Saier,M.H. Jr.
Novel phosphotransferase-encoding genes revealed by analysis of the Escherichia coli genome: a chimeric gene encoding an Enzyme I
homologue that possesses a putative sensory transduction domain
Gene 181 (1-2), 103-108 (1996)
Medline: 97128775

Su,H., Moniakis,J. and Newman,E.B.
Use of gene fusions of the structural gene sdaA to purify L-serine
deaminase 1 from Escherichia coli K-12.
Eur. J. Biochem. 211 (3), 521-527 (1993)
Medline: 93170282

Su,H.S., Lang,B.F. and Newman,E.B.
L-serine degradation in Escherichia coli K-12: cloning and
sequencing of the sdaA gene
J. Bacteriol. 171 (9), 5095-5102 (1989)
Medline: 89359152




Comment:
Oklahoma ID: NGO.1773

Blast Summary:  PSI-Blast Search
Residues 1-461 are 93% similar to L-serine dehydratase from Neisseria meningitidis group B strain MD58 group B strain MD58 (gb|AAF40667.1|).

Numerous hits in gapped BLAST to L-serine dehydratase sequences,e.g.residues 2-447 are 50% similar to L-serine dehydratase from Pseudomonas aeruginosa strain PAO1 (gb|AAG05831.1|).Residues 1-444 are 50% similar to L-serine dehydratase from Escherichia coli K12 (gb|AAC75839.1|).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1760
COG name: L-serine deaminase
Functional Class:  E
The phylogenetic pattern of COG1760 is --------EBrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-125 are 42% similar to a (L-SERINE DEHYDRATASE DEAMINASE SDH LYASE IRON-SULFUR) protein domain (PD009440) which is seen in SDHL_MYCTU.

Residues 181-447 are 61% similar to a (L-SERINE DEHYDRATASE DEAMINASE SDH LYASE IRON-SULFUR) protein domain (PD008627) which is seen in SDHL_STRCO.



Paralogs:  Local Blast Search


NG1773 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 154 (E-value = 2e-55) place NG1773 in the SDH_beta family which is described as Serine dehydratase beta chain (PF03315)
Residues 167 to 446 (E-value = 1e-131) place NG1773 in the SDH_alpha family which is described as Serine dehydratase alpha chain (PF03313)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
93
non-globular  
170  
291

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MISIFDIFKIGIGPSSSHTVGPMKAAAAFAAGLDAQTARIAIDIYGSLAL
TGYGHGTFDALMLGLEGSLPHDIPLAGIPERLGRIRTQHILRLNGQEIRF
IPDRDLNIRGNQVLPKHPNGLRFTAYASDGTVLKEQVYYSVGGGFVVTEE
DFEWQSETEKAVPYPYNSCAGLLARCRLNRLDISEVVLANEAALAGCGEA
EIRRRVAGVAEIMEECIKRGLNAGGELPGGLNVRRRAPQLAAKLKVLRET
EIVNTRLWPMVYAMAVNEENAAGGRVVTAPTNGAAGIIPAVLHYFRKFNP
HATQERVENFLLTAGAIGILYKTNASISGADVGCQGEVGVACSMAAGAYA
EVIGGTPKQVENAAEMAMEHHLGLTCDPVGGLVQIPCIERNGIAAEKALK
LGTLALLEDGTDKKVSLDEVIRTMLQTGRDMKATYKETSLAGLAATLRKK
AVPVSVRVVEC

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCAGCATTTTTGATATTTTCAAAATCGGTATCGGCCCTTCCAGTTC
GCATACGGTCGGCCCGATGAAGGCCGCCGCCGCCTTTGCCGCAGGCTTGG
ACGCGCAAACCGCCCGCATCGCCATCGACATTTACGGCTCGCTTGCCCTG
ACCGGATACGGACACGGCACATTTGACGCGCTGATGCTCGGTTTGGAAGG
CAGCCTGCCGCACGACATCCCGCTTGCCGGCATTCCCGAACGCCTCGGAC
GCATCCGCACGCAGCACATCCTCCGGCTCAACGGGCAAGAAATCCGCTTC
ATCCCCGACCGCGACCTGAACATACGCGGCAATCAAGTGCTGCCCAAACA
CCCCAACGGCCTGCGATTTACCGCCTATGCTTCAGACGGCACGGTATTGA
AGGAACAGGTTTATTATTCGGTCGGCGGCGGCTTTGTCGTTACCGAAGAA
GACTTCGAGTGGCAGTCGGAAACGGAAAAAGCCGTTCCTTATCCTTACAA
CAGTTGTGCCGGGCTGCTTGCCCGATGCCGTCTGAACCGGCTCGACATCT
CCGAAGTCGTGTTGGCAAACGAAGCCGCGCTTGCCGGATGCGGCGAAGCC
GAAATCCGCCGCCGGGTTGCCGGTGTTGCCGAGATTATGGAAGAGTGCAT
CAAACGGGGCTTAAACGCAGGCGGCGAACTGCCCGGCGGATTGAACGTCC
GCCGCCGCGCCCCGCAGCTTGCCGCCAAACTCAAAGTCCTGCGCGAAACC
GAAATCGTCAACACCCGGCTCTGGCCGATGGTGTACGCCATGGCGGTCAA
CGAAGAAAACGCCGCCGGCGGACGCGTCGTTACCGCCCCGACCAACGGCG
CGGCAGGCATCATTCCCGCCGTATTGCATTATTTCCGCAAGTTCAACCCC
CACGCCACACAGGAACGTGTCGAAAACTTCCTGCTCACCGCAGGCGCAAT
CGGCATCCTCTACAAAACCAACGCCTCCATTTCCGGCGCGGATGTCGGTT
GTCAGGGCGAAGTCGGCGTAGCGTGTTCAATGGCGGCGGGTGCATACGCC
GAAGTCATCGGCGGCACGCCCAAACAAGTGGAAAACGCCGCCGAAATGGC
AATGGAACACCATTTGGGCTTAACTTGCGACCCCGTCGGCGGGTTGGTGC
AAATCCCCTGCATCGAACGCAACGGCATCGCCGCCGAAAAAGCCCTCAAA
CTCGGCACGCTCGCGCTCTTGGAAGACGGCACGGACAAAAAAGTCTCGCT
CGACGAAGTCATCCGAACCATGCTGCAAACCGGCCGGGACATGAAGGCGA
CCTACAAAGAAACCTCGCTTGCCGGACTCGCCGCCACGCTCCGGAAAAAA
GCCGTCCCCGTATCCGTGCGCGTGGTCGAGTGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy