Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Val-3 tRNA-Val-2 tRNA-Asp-2 tRNA-Asp-1 IGR1443 IGR1445 IGR1444 IGR1442 IGR1446 NG1771 kefB,kefC, - NG1774 prlC, - NG1770 sdaA,sdaB, - NG1773 gyrB, - NG1772 NG1771 kefB,kefC, - NG1774 prlC, - NG1770 sdaA,sdaB, - NG1773 gyrB, - NG1772 NG1771 kefB,kefC, - NG1774 prlC, - NG1770 sdaA,sdaB, - NG1773 gyrB, - NG1772
* Calculated from Protein Sequence

Gene ID: NG1772

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrB  

Definition:
DNA gyrase chain B / DNA topoisomerase (ATP-hydrolyzing)

Gene Start:
1738591

Gene Stop:
1740978

Gene Length:
2388

Molecular Weight*:
88204

pI*:
5.40

Net Charge*:
-19.54

EC:
5.99.1.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Primary Evidence:
Stein,D.C., Danaher,R.J. and Cook,T.M.
Characterization of a gyrB mutation responsible for low-level
nalidixic acid resistance in Neisseria gonorrhoeae
Antimicrob. Agents Chemother.35 (4),622-626 (1991)
Medline: 91298684.

Secondary Evidence:
Yamagishi,J., Yoshida,H., Yamayoshi,M. and Nakamura,S.
Nalidixic acid-resistant mutations of the gyrB gene of Escherichia
coli
Mol. Gen. Genet. 204 (3), 367-373 (1986)
Medline: 87014111

Adachi,T., Mizuuchi,M., Robinson,E.A., Appella,E., O'Dea,M.H.,
Gellert,M. and Mizuuchi,K.
DNA sequence of the E. coli gyrB gene: application of a new
sequencing strategy.
Nucleic Acids Res. 15 (2), 771-784 (1987)
Medline: 87146392

Funatsuki,K., Tanaka,R., Inagaki,S., Konno,H., Katoh,K. and
Nakamura,H.
acrB mutation located at carboxyl-terminal region of gyrase B
subunit reduces DNA binding of DNA gyrase
J. Biol. Chem. 272 (20), 13302-13308 (1997)
Medline: 97294746

Menzel,R. and Gellert,M.
Fusions of the Escherichia coli gyrA and gyrB control regions to
the galactokinase gene are inducible by coumermycin treatment
J. Bacteriol. 169 (3), 1272-1278 (1987)
Medline: 87137287

Vizan,J.L., Hernandez-Chico,C., del Castillo,I. and Moreno,F.
The peptide antibiotic microcin B17 induces double-strand cleavage
of DNA mediated by E. coli DNA gyrase
EMBO J. 10 (2), 467-476 (1991)
Medline: 91122055


Yoshida,H., Bogaki,M., Nakamura,M., Yamanaka,L.M. and Nakamura,S.
Quinolone resistance-determining region in the DNA gyrase gyrB gene of Escherichia coli
Antimicrob. Agents Chemother. 35 (8), 1647-1650 (1991)
Medline: 92027669

Holdgate,G.A., Tunnicliffe,A., Ward,W.H., Weston,S.A.,
Rosenbrock,G., Barth,P.T., Taylor,I.W., Pauptit,R.A. and Timms,D.
The entropic penalty of ordered water accounts for weaker binding
of the antibiotic novobiocin to a resistant mutant of DNA gyrase: a thermodynamic and crystallographic study
Biochemistry 36 (32), 9663-9673 (1997)
Medline: 97392632



Comment:
From GenBANK (gi:1346236): DNA gyrase negatively supercoils closed circular double-stranded DNA in an ATP-dependent manner and also catalyzes the interconversion of other topological isomers of
double-stranded DNA rings, including catenanes and knotted rings. Catalytic activity: ATP-dependent breakage, passage and rejoining of double-stranded DNA. This is made up of two chains; the A chain is responsible for dna breakage and rejoining; the B chain catalyzes ATP hydrolysis. The enzyme forms an A2B2 tetramer.

See also NG0629, DNA gyrase subunit A.

Oklahoma ID: NGO.1772

Blast Summary:  PSI-Blast Search
NG1772 is 97% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 482597.

Residues 1-796 are 98% similar to DNA gyrase chain B from Neisseria meningitidis group B strain MC58 (gb|AAF40668.1).

Numerous hits in gapped BLAST to DNA gyrase B subunit / DNA topoisomerase (ATP-hydrolyzing) sequences,e.g.residues 9-795 are 60% similar to DNA gyrase subunit B from Escherichia coli O157:H7 (121888).Residues 5-795 are 58% similar to DNA gyrase subunit B from Pseudomonas aeruginosa strain PAO1 (gb|AAG03394.1|).Residues 3-789 are 45% similar to DNA gyrase subunit B from Chlamydia trachomatis serotype D, strain UW3/Cx (gb|AAC67782.1|).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0187
COG name: DNA gyrase (topoisomerase II) B subunit
Functional Class:  L
The phylogenetic pattern of COG0187 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001241 (DNA topoisomerase II family) with a combined E-value of 2.3e-142.
    IPB001241A    14-35
    IPB001241B    113-131
    IPB001241C    168-180
    IPB001241D    271-284
    IPB001241E    317-343
    IPB001241F    422-470
    IPB001241G    491-517
    IPB001241H    729-752


ProDom Summary:  Protein Domain Search
Residues 399-473 are 84% similar to a (TOPOISOMERASE ISOMERASE ATP-BINDING DNA SUBUNIT B GYRASE) protein domain (PD000714) which is seen in O86093_BBBBB.

Residues 483-558 are 98% similar to a (TOPOISOMERASE ISOMERASE ATP-BINDING DNA SUBUNIT B GYRASE) protein domain (PD000616) which is seen in GYRB_NEIGO.

Residues 560-718 are 93% similar to a (DNA GYRASE SUBUNIT B) protein domain (PD013226) which is seen in GYRB_NEIGO.

Residues 148-364 are identical to a (TOPOISOMERASE SUBUNIT ISOMERASE ATP-BINDING B DNA GYRASE) protein domain (PD001260) which is seen in GYRB_NEIGO.

Residues 724-785 are 95% similar to a (TOPOISOMERASE SUBUNIT ISOMERASE) protein domain (PD149633) which is seen in GYRB_NEIGO.

Residues 5-131 are 89% similar to a (TOPOISOMERASE ISOMERASE ATP-BINDING DNA SUBUNIT B GYRASE) protein domain (PD000740) which is seen in GYRB_NEIGO.



Paralogs:  Local Blast Search


NG1772 is paralogously related to NG1333 (DNA topoisomerase IV subunit B) (3e-96).


Pfam Summary:  Pfam Search
Residues 35 to 178 (E-value = 2e-32) place NG1772 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 224 to 394 (E-value = 1.9e-86) place NG1772 in the DNA_gyraseB family which is described as DNA gyrase B (PF00204)
Residues 421 to 533 (E-value = 2.8e-06) place NG1772 in the Toprim family which is described as Toprim domain (PF01751)
Residues 720 to 785 (E-value = 7.8e-48) place NG1772 in the DNA_gyraseB_C family which is described as DNA gyrase B subunit, carboxyl terminus (PF00986)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
621  
651

PDB Hit:
pdb|1EI1|1EI1-A DIMERIZATION OF E. COLI DNA GYRASE B PROVIDES A 472.0 0e+00
pdb|1KIJ|1KIJ-A CRYSTAL STRUCTURE OF THE 43K ATPASE DOMAIN OF 302.0 2e-82
pdb|1AJ6|1AJ6 NOVOBIOCIN-RESISTANT MUTANT (R136H) OF THE 270.0 9e-73
pdb|1KZN|1KZN-A CRYS

Gene Protein Sequence:
MTEQKHEEYGADSIQVLEGLEAVRKRPGMYIGDTQDGSGLHHMVFEVLDN
AIDEALAGHCDKITVTIHADHSVSVADNGRGMPTGIHPKEGRSAAEVIMT
VLHAGGKFDNNSYKISGGLHGVGVSVVNALSDWVTLTIYRDGKEHFVRFV
RGETEEPLKIVGDSDKKGTTVRFLAGTETFGNIEYSFDILAKRIRELSFL
NNGVDIELTDERDGKHESFALSGGVAGFVQYMNRKKTPLHEKIFYAFGEK
DGMSVECAMQWNDSYQESVQCFTNNIPQRDGGTHLTALRQVMTRTINSYI
EANEVAKKAKVETAGDDMREGLTCVLSVKLPDPKFSSQTKDKLVSGEIGP
VVNEVINQALTDFLEENPNEAKIITGKIVDAARAREAARKAREITRRKGV
MDGLGLPGKLADCQEKDPALSELYLVEGDSAGGSAMQGRDRKFQAILPLK
GKILNVEKARFEKMLASQEVATLITALGAGIGKEEFNPEKLRYHRIIIMT
DADVDGAHIRTLLLTFFYRQMPELVERGYIYIAQPPLYKAKYGKQERYLK
DELEKDQWLLGLALEKAKIVSDGRTIEGAELADTAKQFLLAKTVIEQESR
FVDELVLRAMLHASPIDLTSSENADKAVAELSGLLDEKEAALERIEGHEG
HRFIKITRKLHGNVMVSYIEPKFLNSKAYQTLTQTAAALKGLVGEGAKLY
KGENEYDADSFETALDILMSVAQKGMSIQRYKGLGEMNPEQLWETTMDPA
VRRLLKVRIEDAIAADEVFVTLMGDEVEPRRAFIENNALIAQNIDA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGAACAAAAACACGAAGAATACGGCGCCGACAGCATCCAGGTGCT
CGAAGGCTTGGAAGCGGTACGCAAACGCCCCGGCATGTACATCGGCGACA
CGCAGGACGGCAGCGGCCTGCACCATATGGTGTTTGAAGTATTGGACAAC
GCCATCGACGAAGCACTCGCCGGACATTGCGACAAAATCACGGTAACGAT
ACACGCCGACCATTCCGTCAGCGTCGCCGACAACGGGCGCGGTATGCCCA
CCGGCATCCACCCGAAAGAAGGGCGTTCCGCCGCCGAAGTCATCATGACC
GTCTTGCACGCGGGCGGCAAATTCGACAACAACAGCTACAAAATCTCCGG
CGGCCTGCACGGCGTGGGCGTATCCGTCGTCAACGCGCTGTCCGACTGGG
TAACGCTGACCATCTACCGCGACGGCAAAGAACACTTCGTCCGCTTCGTA
CGCGGCGAAACCGAAGAGCCGCTGAAAATTGTCGGCGATTCCGACAAAAA
AGGCACGACCGTGCGCTTCCTCGCCGGCACGGAAACCTTCGGCAATATCG
AATACAGCTTCGACATCCTCGCCAAACGTATTCGCGAACTTTCGTTCCTA
AACAACGGCGTGGACATCGAATTGACCGACGAGCGCGACGGCAAGCACGA
AAGCTTCGCCCTTTCCGGCGGCGTGGCGGGCTTCGTGCAATACATGAACC
GCAAAAAAACGCCCTTGCACGAAAAAATCTTCTATGCGTTCGGCGAGAAA
GACGGCATGAGCGTCGAATGCGCAATGCAATGGAACGACAGCTATCAGGA
AAGCGTGCAGTGCTTCACCAACAACATCCCTCAGCGCGACGGCGGTACGC
ACCTGACCGCGCTGCGCCAAGTGATGACGCGCACCATCAACAGCTACATC
GAAGCTAACGAAGTCGCCAAAAAAGCCAAAGTGGAAACCGCCGGCGACGA
TATGCGCGAAGGTTTGACCTGCGTGTTGTCCGTCAAACTGCCCGACCCCA
AATTCTCATCCCAAACCAAAGACAAACTGGTTTCCGGCGAAATCGGCCCC
GTTGTCAACGAAGTCATCAACCAAGCACTAACCGACTTCCTCGAAGAAAA
TCCGAACGAAGCCAAAATCATCACCGGCAAAATCGTCGATGCCGCCCGCG
CACGCGAAGCCGCCCGCAAAGCCCGCGAAATCACCCGCCGCAAAGGCGTG
ATGGACGGCTTGGGACTGCCCGGCAAACTCGCCGACTGCCAAGAAAAAGA
CCCTGCCCTGTCTGAACTCTACCTCGTCGAGGGCGACTCCGCAGGCGGTT
CCGCCATGCAGGGCCGCGACCGCAAATTCCAAGCGATTTTGCCGCTCAAA
GGTAAAATTTTGAACGTCGAAAAAGCACGTTTTGAAAAAATGCTCGCCAG
CCAAGAGGTCGCCACCCTGATTACCGCGCTGGGTGCAGGCATCGGCAAAG
AAGAGTTCAACCCTGAAAAACTACGCTACCACCGCATCATCATCATGACC
GATGCCGACGTGGACGGTGCGCACATCCGCACCCTGCTCCTGACCTTCTT
CTACCGCCAAATGCCCGAACTGGTCGAGCGCGGCTACATTTACATCGCCC
AGCCGCCGCTCTACAAAGCCAAATACGGCAAGCAGGAGCGTTACCTCAAA
GACGAACTGGAAAAAGACCAATGGCTGCTCGGCCTTGCCTTGGAAAAAGC
CAAAATCGTTTCAGACGGCCGCACCATCGAAGGCGCAGAACTTGCCGACA
CCGCCAAACAATTCTTGTTGGCGAAAACCGTCATCGAACAGGAAAGCCGC
TTCGTGGACGAACTCGTCCTGCGTGCCATGCTGCACGCGTCGCCCATTGA
TTTGACGTCGTCTGAAAACGCCGATAAAGCCGTTGCCGAACTTTCCGGTT
TGCTTGACGAAAAAGAAGCCGCCCTCGAACGCATCGAAGGTCATGAAGGA
CACCGGTTCATCAAAATCACGCGCAAGCTGCACGGCAACGTCATGGTCAG
CTACATCGAACCCAAGTTCCTCAACAGCAAAGCCTACCAAACCCTCACCC
AAACCGCCGCCGCGCTCAAAGGCTTGGTCGGCGAGGGCGCCAAGCTCTAC
AAAGGCGAGAACGAGTACGACGCGGACAGCTTTGAAACCGCTTTGGACAT
CTTGATGAGCGTTGCCCAAAAAGGTATGTCCATCCAACGATACAAAGGTT
TGGGCGAGATGAACCCCGAGCAGCTTTGGGAAACCACGATGGATCCCGCC
GTGCGCCGCCTGTTGAAAGTGCGCATCGAAGATGCCATTGCCGCCGACGA
AGTGTTCGTTACCCTGATGGGCGACGAGGTCGAACCGCGCCGCGCCTTTA
TCGAAAACAATGCGCTGATTGCGCAAAATATCGACGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy