Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1443 IGR1445 IGR1444 IGR1441 IGR1440 IGR1442 NG1771 prlC, - NG1770 NG1768 cpx,yhjA, - NG1769 sdaA,sdaB, - NG1773 kat,katA, - NG1767 gyrB, - NG1772 NG1771 prlC, - NG1770 NG1768 cpx,yhjA, - NG1769 sdaA,sdaB, - NG1773 kat,katA, - NG1767 gyrB, - NG1772 NG1771 prlC, - NG1770 NG1768 cpx,yhjA, - NG1769 sdaA,sdaB, - NG1773 kat,katA, - NG1767 gyrB, - NG1772
* Calculated from Protein Sequence

Gene ID: NG1770

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
prlC  

Definition:
oligopeptidase A; peptidyl-dipeptidase

Gene Start:
1737365

Gene Stop:
1735332

Gene Length:
2034

Molecular Weight*:
75897

pI*:
5.50

Net Charge*:
-15.16

EC:
3.4.24.15  3.4.24.70  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Conlin,C.A., Trun,N.J., Silhavy,T.J. and Miller,C.G.
Escherichia coli prlC encodes an endopeptidase and is homologous to the Salmonella typhimurium opdA gene
J. Bacteriol. 174 (18),5881-5887 (1992)
Medline: 92394891


Conlin,C.A. and Miller,C.G.
Location of the prlC (opdA) gene on the physical map of Escherichia coli
J. Bacteriol. 175 (17), 5731-5732 (1993)
Medline: 93374878

Comment:
Oklahoma ID: NGO.1770c

Blast Summary:  PSI-Blast Search
Residues 1-677 are 91% similar to oligopeptidase A from Neisseria meningitidis group B strain MD58 (gb|AAF40670.1|).

Numerous hits in gapped BLAST to oligopeptidase A / peptidyl-dipeptidase sequences,e.g.residues 1-673 are 47% similar to oligopeptidase A from Pseudomonas aeruginosa strain PAO1 (gb|AAG03457.1|).Residues 4-673 are 45% similar to oligopeptidase A from Escherichia coli K12 (gb|AAB18474.1|).Residues 2-673 are 48% similar to oligopeptidase A from Xylella fastidiosa strain 9a5c (gb|AAF82940.1|).Residues 13-673 are 29% similar to peptidyl-dipeptidase from Mesorhizobium loti (14024262|).

COGS Summary:  COGS Search
BeTs to 3 clades of COG0339
COG name: Zn-dependent oligopeptidases
Functional Class:  E
The phylogenetic pattern of COG0339 is ----Y--cE--h---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-673 are 46% similar to a (HYDROLASE METALLOPROTEASE ZINC OLIGOPEPTIDASE PRECURSOR) protein domain (PD002945) which is seen in OPDA_HAEIN.



Paralogs:  Local Blast Search


NG1770 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 222 to 674 (E-value = 1.5e-169) place NG1770 in the Peptidase_M3 family which is described as Peptidase family M3 (PF01432)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
66

PDB Hit:
pdb|1I1I|1I1I-P NEUROLYSIN (ENDOPEPTIDASE 24.16) CRYSTAL 214.0 3e-56

Gene Protein Sequence:
MIDNALLHLGEEPRFNQIKTEDIKPAVQTAIAEARGQIAAVKAQTHTGWA
NTVERLTGITERVGRIWGVVSHLNSVVDTPELRAVYNELMPEITVFFTEI
GQDIELYNRFKTIKNSPEFATLSPAQKTKLDHDLRDFVLSGAELPPERQA
ELAKLQTEGAQLSAKFSQNVLDATDAFGIYFDDAAPLAGIPEDALAMFAA
AAQSEGKTGYKIGLQIPHYLAVIQYAGNRELREQIYRAYVTRASELSNDG
KFDNTANIDRTLENALKTAKLLGFKNYAELSLATKMADTPEQVLNFLHDL
ARRAKPYAEKDLAEVKAFAREHLGLADPQPWDLSYAGEKLREAKYAFSET
EVKKYFPVGKVLAGLFAQIKKLYGIGFAEKTVPVWHKDVRYFELQQNGKT
IGGVYMDLYAREGKRGGAWMNDYKGRRRFADGTLQLPTAYLVCNFAPPVG
GKEARLSHDEILTLFHETGHGLHHLLTQVDELGVSGINGVEWDAVELPSQ
FMENFVWEYNVLAQMSAHEETGEPLPKELFDKMLAAKNFQRGMFLVRQME
FALFDMMIYSESDECRLKNWQQVLDSVRKEVAVIQPPEYNRFANSFGHIF
AGGYSAGYYSYAWAEVLSTDAYAAFEESDDVAATGKRFWQEILAVGGSRS
AAESFKAFRGREPSIDALLRHSGFDNAA

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGACAACGCACTGCTCCACTTGGGCGAAGAACCCCGTTTTAATCA
AATCAAAACCGAAGACATCAAACCCGCCGTCCAAACCGCCATCGCCGAAG
CGCGCGGACAAATCGCCGCCGTCAAAGCGCAAACGCACACCGGCTGGGCG
AACACCGTCGAGCGTCTGACCGGCATCACCGAACGCGTCGGCAGGATTTG
GGGCGTCGTGTCCCATCTCAACTCCGTCGTCGACACGCCCGAACTGCGCG
CCGTCTATAACGAACTGATGCCTGAAATCACCGTCTTCTTCACCGAAATC
GGACAAGACATCGAACTGTACAACCGCTTCAAAACCATCAAAAATTCCCC
CGAATTTGCAACGCTTTCCCCCGCACAAAAAACCAAGCTCGATCACGACC
TGCGCGATTTCGTATTGAGCGGCGCGGAACTGCCGCCCGAACGGCAGGCA
GAACTGGCAAAACTGCAAACCGAAGGCGCGCAACTTTCCGCCAAATTCTC
CCAAAACGTCCTAGACGCGACCGACGCGTTCGGCATTTACTTTGACGATG
CCGCACCGCTTGCCGGCATTCCCGAAGACGCGCTCGCCATGTTTGCCGCC
GCCGCGCAAAGCGAAGGCAAAACAGGTTACAAAATCGGCTTGCAGATTCC
GCACTACCTTGCCGTTATCCAATACGCCGGCAACCGCGAACTGCGCGAAC
AAATCTACCGCGCCTACGTTACCCGTGCCAGCGAACTTTCAAACGACGGC
AAATTCGACAACACCGCCAACATCGACCGCACGCTCGAAAACGCATTGAA
AACCGCCAAACTGCTCGGCTTTAAAAATTACGCCGAATTGTCGCTGGCAA
CCAAAATGGCGGACACGCCCGAACAGGTTTTAAACTTCCTGCACGACCTC
GCCCGCCGCGCCAAACCCTACGCCGAAAAAGACCTCGCCGAAGTCAAAGC
CTTCGCCCGCGAACACCTCGGTCTCGCCGACCCGCAGCCGTGGGACTTGA
GCTACGCCGGCGAAAAACTGCGCGAAGCCAAATACGCATTCAGCGAAACC
GAAGTCAAAAAATACTTCCCCGTCGGCAAAGTTCTGGCAGGCCTGTTCGC
CCAAATCAAAAAACTCTACGGCATCGGATTCGCCGAAAAAACCGTTCCCG
TCTGGCACAAAGACGTGCGCTATTTTGAATTGCAACAAAACGGCAAAACC
ATCGGCGGCGTTTATATGGATTTGTACGCACGCGAAGGCAAACGCGGCGG
CGCGTGGATGAACGACTACAAAGGCCGCCGCCGCTTTGCCGACGGCACGC
TGCAACTGCCCACCGCCTACCTCGTCTGCAACTTCGCCCCGCCCGTCGGC
GGCAAAGAAGCGCGTTTAAGCCACGACGAAATCCTCACCCTCTTCCACGA
AACCGGCCACGGACTGCACCACCTGCTTACCCAAGTGGACGAACTGGGCG
TGTCCGGCATCAACGGCGTAGAATGGGACGCGGTCGAACTGCCCAGCCAG
TTTATGGAAAACTTCGTTTGGGAATACAATGTATTGGCACAAATGTCCGC
CCACGAAGAAACCGGCGAGCCCCTGCCGAAAGAACTCTTCGACAAAATGC
TCGCCGCCAAAAACTTCCAGCGCGGTATGTTCCTCGTCCGGCAAATGGAG
TTCGCCCTCTTCGATATGATGATTTACAGTGAAAGCGACGAATGCCGTCT
GAAAAACTGGCAGCAGGTTTTAGACAGCGTGCGCAAAGAAGTCGCCGTCA
TCCAACCGCCCGAATACAACCGCTTCGCCAACAGCTTCGGCCACATCTTC
GCCGGCGGCTATTCCGCAGGCTATTACAGCTACGCATGGGCCGAAGTCCT
CAGCACCGATGCCTACGCCGCCTTTGAAGAAAGCGACGACGTCGCCGCCA
CAGGCAAACGCTTCTGGCAAGAAATCCTTGCCGTCGGCGGCTCCCGCAGC
GCGGCGGAATCCTTCAAAGCCTTCCGCGGACGCGAACCGAGCATAGACGC
ACTGCTGCGCCACAGCGGCTTCGACAACGCGGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy