Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1443 IGR1444 IGR1441 IGR1439.1 IGR1439 IGR1440 IGR1442 RP54, - NG1766 NG1771 prlC, - NG1770 NG1768 cpx,yhjA, - NG1769 kat,katA, - NG1767 gyrB, - NG1772 RP54, - NG1766 NG1771 prlC, - NG1770 NG1768 cpx,yhjA, - NG1769 kat,katA, - NG1767 gyrB, - NG1772 Type: tandem, Name:  - 83 RP54, - NG1766 NG1771 prlC, - NG1770 NG1768 cpx,yhjA, - NG1769 kat,katA, - NG1767 gyrB, - NG1772
* Calculated from Protein Sequence

Gene ID: NG1769

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cpx  yhjA  

Definition:
probable cytochrome c peroxidase

Gene Start:
1733585

Gene Stop:
1734745

Gene Length:
1161

Molecular Weight*:
41942

pI*:
5.60

Net Charge*:
-5.00

EC:
1.11.1.5  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table

Secondary Evidence:
Samyn,B.,Van Craenenbroeck,K.,De Smet,L.,Vandenberghe,I.,
Pettigrew,G. and Van Beeumen,J.
A reinvestigation of the covalent structure of Pseudomonas aeruginosa cytochrome c peroxidase
FEBS Lett.377(2),145-149(1995)
Medline: 96128216

Ronnberg,M.,Kalkkinen,N.and Ellfolk,N.
The primary structure of Pseudomonas cytochrome c peroxidase
FEBS Lett. 250 (2), 175-178 (1989)
Medline: 89325562

Ellfolk,N.,Ronnberg,M.and Osterlund,K.
Structural and functional features of Pseudomonas cytochrome c
peroxidase
Biochim. Biophys. Acta 1080(1),68-77(1991)
Medline: 92031653


Comment:
For other 'cpx' genes see NG0177 (cpxR).

Oklahoma ID: NGO.1769

Blast Summary:  PSI-Blast Search
No hits found in N.meningitidis

Numerous hits in gapped BLAST to cytochrome-c peroxidase sequences,e.g. residues 60-385 are 53% similar to the enzyme cytochrome-c peroxidase from Aquifex aeolicus (gb|AAC06485.1|). Residues 66-384 are 48% similar to the enzyme cytochrome-c peroxidase from Pseudomonas aeruginosa, Peptide, 323 aa (gb|AAB50671.1|).Residues 72-362 are 45% similar to the enzyme cytochrome-c peroxidase from Escherichia coli (gb|AAB18494.1|).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1858
COG name: Cytochrome c peroxidase
Functional Class:  P
The phylogenetic pattern of COG1858 is -----q--e---uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 71-375 are 55% similar to a (PEROXIDASE CYTOCHROME HEME ELECTRON) protein domain (PD010012) which is seen in O66533_AQUAE.



Paralogs:  Local Blast Search
NG1769 is paralogously related to NG0994 (H.8 outer membrane protein) (9e-04).


Pfam Summary:  Pfam Search
Residues 67 to 240 (E-value = 1.3e-77) place NG1769 in the CCP_MauG family which is described as Di-haem cytochrome c peroxidase (PF03150)

Structural Feature(s):
Feature Type  Start  Stop
may be a lipoprotein  
  
gram negative signal  
1  
20
non-globular  
21  
62

PDB Hit:
pdb|1EB7|1EB7-A CRYSTAL STRUCTURE OF THE DI-HAEM CYTOCHROME C 303.0 3e-83
pdb|1IQC|1IQC-A CRYSTAL STRUCTURE OF DI-HEME PEROXIDASE FROM 449.0 0e+00

Gene Protein Sequence:
MSFKLRYLASVLALSSLLAACGGQEKSAAGDASPASETEAASQVQASEAV
PSASSASPEDQDLLKRAQGVFQPLPTVEEMQKIRPFTEEQVKLGHQLWYE
PRLSKGNTVSCNSCHNLASAGVDNMPTSQGHKGQFGGRNSPTALNAALLG
SQFWDGRAADVEEQAGGPLVNPVEMANDSQEAAAAKIAKVPEYQEMFKKA
FPEDGAVSFKNITTALGAFERTLLTPTKWDEYLKGNVNALSEQERKGVRA
FMDNGCIACHNGVNLGGTTFQKFGLVQGPYWKFIEDPKRDKGRADVTKKT
EDEFFFRVPGLRNVAKTYPYFHNGSVWELDKAVTIMGKAQLGKDIPKEDV
DNIVVFLNALSGNVSESARTMPELPLTAPMESKPDNK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTTCAAACTCCGTTACCTCGCATCAGTATTGGCATTGTCTTCACT
GTTGGCGGCATGCGGCGGTCAGGAAAAGTCTGCGGCAGGCGATGCTTCTC
CTGCTTCCGAGACCGAAGCGGCTTCCCAAGTACAGGCCTCGGAAGCCGTT
CCTTCCGCTTCATCGGCCTCGCCCGAAGACCAAGACCTTTTGAAACGCGC
GCAAGGTGTATTCCAACCTTTGCCGACTGTCGAAGAAATGCAGAAAATCC
GTCCGTTTACCGAAGAACAGGTCAAACTCGGACACCAACTCTGGTATGAA
CCACGCCTTTCCAAAGGCAATACCGTAAGCTGCAACTCTTGCCACAACCT
TGCTTCCGCCGGTGTGGACAATATGCCGACCAGTCAGGGGCACAAAGGGC
AGTTCGGCGGACGCAACTCGCCTACCGCATTGAATGCTGCGCTGCTGGGC
AGCCAGTTTTGGGACGGACGTGCCGCCGATGTTGAAGAACAGGCTGGCGG
GCCTTTGGTGAATCCGGTGGAAATGGCGAATGATTCGCAAGAGGCGGCTG
CAGCCAAAATCGCCAAAGTTCCCGAATATCAAGAAATGTTTAAAAAAGCT
TTTCCTGAAGACGGCGCGGTTTCGTTTAAAAACATCACTACCGCATTGGG
TGCGTTTGAGCGTACCCTGCTGACGCCGACCAAATGGGACGAATACCTCA
AAGGCAACGTCAACGCCCTGAGCGAACAGGAACGAAAAGGCGTGCGCGCG
TTCATGGACAACGGCTGTATTGCCTGCCACAACGGTGTCAACCTTGGAGG
CACGACCTTCCAGAAATTCGGTCTGGTCCAAGGGCCGTATTGGAAATTCA
TTGAAGATCCGAAACGCGACAAAGGCCGTGCTGACGTAACCAAAAAAACC
GAAGACGAATTTTTCTTCCGTGTTCCGGGGTTGCGTAACGTGGCTAAAAC
TTATCCGTATTTCCACAACGGCAGCGTGTGGGAGCTGGATAAGGCAGTTA
CCATCATGGGTAAGGCGCAATTGGGTAAAGACATTCCGAAAGAAGATGTG
GATAACATCGTCGTATTCCTGAATGCACTTTCCGGCAATGTTTCCGAATC
AGCGCGCACGATGCCGGAACTGCCCCTGACCGCACCGATGGAATCTAAGC
CGGACAACAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy