Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1441 IGR1439.1 IGR1438.1 IGR1438.2 IGR1439 IGR1440 IGR1442 RP54, - NG1766 prlC, - NG1770 NG1438.1 NG1768 NG1764 pglA, - NG1765 cpx,yhjA, - NG1769 kat,katA, - NG1767 RP54, - NG1766 prlC, - NG1770 NG1438.1 NG1768 NG1764 pglA, - NG1765 cpx,yhjA, - NG1769 kat,katA, - NG1767 Type: tandem, Name:  - 82 Type: tandem, Name:  - 83 RP54, - NG1766 prlC, - NG1770 NG1768 NG1764 pglA, - NG1765 cpx,yhjA, - NG1769 kat,katA, - NG1767 NG1438.1
* Calculated from Protein Sequence

Gene ID: NG1767

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
kat  katA  

Definition:
catalase

Gene Start:
1730767

Gene Stop:
1732278

Gene Length:
1512

Molecular Weight*:
57303

pI*:
6.60

Net Charge*:
-2.78

EC:
1.11.1.6  

Functional Class:
Cellular processes; Detoxification  

Pathway: pathway table
Methane metabolism
Tryptophan metabolism

Primary Evidence:
Johnson,S.R., Steiner,B.M. and Perkins,G.H.
Cloning and characterization of the catalase gene of Neisseria
gonorrhoeae: use of the gonococcus as a host organism for
recombinant DNA.
Infect. Immun. 64 (7), 2627-2634 (1996)
Medline: 96294773


Secondary Evidence:
von Ossowski,I., Mulvey,M.R., Leco,P.A., Borys,A. and Loewen,P.C.
Nucleotide sequence of Escherichia coli katE, which encodes
catalase HPII
J. Bacteriol. 173 (2), 514-520 (1991)
Medline: 91100337

Bravo,J., Verdaguer,N., Tormo,J., Betzel,C., Switala,J.,
Loewen,P.C. and Fita,I.
Crystal structure of catalase HPII from Escherichia coli
Structure 3 (5), 491-502 (1995)
Medline: 95393020


Sevinc,M.S., Mate,M.J., Switala,J., Fita,I. and Loewen,P.C.
Role of the lateral channel in catalase HPII of Escherichia coli
Protein Sci. 8 (3), 490-498 (1999)
Medline: 99190072



Comment:
Oklahoma ID: NGO.1767

Blast Summary:  PSI-Blast Search
NG1767 is 92% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1016016.
Residues 1-504 are 98% similar to catalase from Neisseria meningitidis group A strain Z2491,group B strain MD58 (11255568|).

Numerous hits in gapped BLAST to catalase sequences,e.g.residues 3-504 are 91% similar to catalase from Haemophilus influenzae strain Rd KW20 (1074949|).Residues 9-486 are 69% similar to catalase isozyme A from Pseudomonas aeruginosa strain PAO1 (|gb|AAC03118.1|).Residues 11-489 are 41% similar to catalase HPII from Escherichia Coli (gb|AAA24039.1|).

COGS Summary:  COGS Search
BeTs to 4 clades of COG0753
COG name: Catalase
Functional Class:  P
The phylogenetic pattern of COG0753 is ----Y---eB-hUJ-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002226 (Catalase) with a combined E-value of 7.6e-182.
    IPB002226A    33-84
    IPB002226B    98-150
    IPB002226C    174-205
    IPB002226D    232-285
    IPB002226E    311-362


ProDom Summary:  Protein Domain Search
Residues 59-343 are 29% similar to a (PROTEIN CATALASE-LIKE PUTATIVE SRPA PRECURSOR SIGNAL) protein domain (PD188432) which is seen in SRPA_SYNP7.



Paralogs:  Local Blast Search


NG1767 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 12 to 396 (E-value = 4.4e-297) place NG1767 in the Catalase family which is described as Catalase (PF00199)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1M85|1M85-A STRUCTURE OF PROTEUS MIRABILIS CATALASE FOR THE 686.0 0.000000
pdb|1E93|1E93-A HIGH RESOLUTION STRUCTURE AND BIOCHEMICAL 684.0 0.000000
pdb|1DGH|1DGH-A 507.0 0e+00
pdb|1F4J|1F4J-A STRUCTURE OF TETRAGONAL CRYSTALS OF HUMAN

Gene Protein Sequence:
MTTSKCPVTHLTMNNGAPVADNQNSLTAGPRGPLLTQDLWLNEKLADFVR
EVIPERRMHAKGSGAFGTFTVTHDITKYTRAKIFSEVGKKTEMFARFTTV
AGERGAADAERDIRGFALKFYTEEGNWDVVGNNTPVFFLRDPRKFPDLNK
AVKRDPRTNMRSATNNWDFWTLLPEALHQVTIVMSDRGIPASYRHMHGFG
SHTYSFWNEAGERFWVKFHFRSQQGIKNLTNEEAAKIIADDRESHQRDLY
EAIERGEFPKWTMYIQVMPEADAEKVPYHPFDLTKVWPKKDYPLIEVGEF
ELNRNPENFFADVEQSAFAPSNLVPGIGASPDKMLQARLFNYADAQRYRL
GVNFRQIPVNRPRCPVHSNQRDGQGRADGNYGSLPHYEPNSFGQWQQQPD
FAEPPLKINGDAAHWDYRQDDDDYFSQPRALFNLMNDAQKQALFDNTAAA
MGDAPDFIKYRHIRNCYRCDPAYGEGVAKALGLTVEDAQAVRATDPALGQ
AGLL

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTACCTCCAAATGCCCCGTAACCCATCTGACCATGAACAACGGCGC
GCCCGTTGCCGACAATCAAAACAGCCTGACCGCCGGCCCGCGCGGCCCCC
TGCTGACGCAAGATTTGTGGCTGAATGAAAAACTCGCCGACTTCGTGCGC
GAAGTCATCCCCGAACGCCGTATGCACGCCAAAGGTTCGGGCGCGTTCGG
TACGTTTACCGTAACACACGACATCACCAAATACACCCGCGCCAAAATTT
TCAGCGAAGTCGGCAAAAAAACCGAGATGTTCGCCCGTTTCACCACCGTG
GCAGGCGAGCGCGGCGCAGCCGATGCGGAACGCGACATCCGCGGTTTTGC
GTTGAAATTCTATACCGAAGAAGGCAACTGGGATGTGGTCGGCAACAACA
CGCCCGTGTTCTTCCTGCGCGACCCGCGCAAATTCCCCGACCTGAACAAA
GCCGTCAAACGCGATCCGCGCACCAATATGCGTTCCGCCACAAACAACTG
GGACTTCTGGACGCTGCTGCCCGAAGCCCTGCACCAAGTTACCATCGTGA
TGAGCGACCGCGGTATTCCCGCCAGCTACCGCCATATGCACGGCTTCGGT
TCGCATACCTACAGCTTCTGGAACGAAGCGGGCGAACGTTTTTGGGTGAA
ATTCCATTTCCGCAGCCAGCAAGGGATTAAAAACCTGACCAACGAAGAAG
CTGCAAAAATCATCGCCGACGACCGCGAAAGCCATCAGCGCGACCTGTAC
GAAGCCATCGAGCGCGGCGAGTTCCCGAAATGGACGATGTACATCCAAGT
CATGCCTGAAGCCGATGCCGAAAAAGTGCCTTATCATCCGTTTGACTTGA
CCAAAGTTTGGCCGAAAAAAGACTATCCGCTGATTGAAGTGGGCGAATTC
GAGTTGAACCGCAATCCCGAAAACTTCTTCGCCGATGTGGAACAATCCGC
CTTCGCACCGAGCAACCTCGTTCCCGGTATCGGCGCGAGCCCGGATAAAA
TGTTGCAAGCCCGTTTGTTCAATTACGCCGACGCGCAACGTTACCGCTTG
GGTGTGAACTTCCGCCAAATCCCCGTCAATCGTCCGCGTTGCCCTGTTCA
CAGCAACCAGCGCGACGGACAAGGCCGCGCCGACGGCAACTACGGCAGCC
TGCCGCACTACGAACCCAACAGCTTCGGCCAATGGCAGCAACAACCCGAC
TTCGCCGAACCGCCTTTGAAAATCAACGGCGACGCGGCACACTGGGACTA
CCGCCAAGACGATGACGACTACTTCAGCCAACCGCGCGCCTTGTTCAACC
TGATGAACGACGCGCAGAAACAGGCTTTGTTTGACAACACCGCCGCAGCC
ATGGGCGATGCGCCCGACTTCATCAAATACCGCCATATCCGCAACTGCTA
CCGTTGCGACCCGGCATACGGTGAAGGCGTAGCCAAAGCCCTCGGACTGA
CCGTCGAAGACGCACAAGCCGTCCGCGCGACCGATCCCGCACTGGGTCAG
GCCGGTTTGCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy