Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1437 IGR1438 IGR1441 IGR1436 IGR1439.1 IGR1438.1 IGR1438.2 IGR1439 IGR1440 RP54, - NG1766 pyrD, - NG1761 acpP, - NG1762 NG1438.1 NG1768 NG1764 pglA, - NG1765 cpx,yhjA, - NG1769 fabF, - NG1763 kat,katA, - NG1767 RP54, - NG1766 pyrD, - NG1761 acpP, - NG1762 NG1438.1 NG1768 NG1764 pglA, - NG1765 cpx,yhjA, - NG1769 fabF, - NG1763 kat,katA, - NG1767 Type: tandem, Name:  - 82 Type: tandem, Name:  - 83 RP54, - NG1766 pyrD, - NG1761 acpP, - NG1762 NG1438.1 NG1764 pglA, - NG1765 cpx,yhjA, - NG1769 fabF, - NG1763 kat,katA, - NG1767 NG1768
* Calculated from Protein Sequence

Gene ID: NG1765

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pglA  

Definition:
probable glycosyltransferase

Gene Start:
1728035

Gene Stop:
1729162

Gene Length:
1128

Molecular Weight*:
41995

pI*:
10.00

Net Charge*:
9.18

EC:
2.4.1.-  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table
Blood group glycolipid biosynthesis - lact series
Blood group glycolipid biosynthesis - neolact series
Fructose and mannose metabolism
Glycerolipid metabolism
Glycoprotein biosynthesis
Peptideglycan biosynthesis
Sphingoglycolipid metabolism

Primary Evidence:
Jennings,M.P., Virji,M., Evans,D., Foster,V., Srikhanta,Y.N.,
Steeghs,L., van der Ley,P. and Moxon,E.R.
Identification of a novel gene involved in pilin glycosylation in
Neisseria meningitidis
Mol. Microbiol. 29 (4), 975-984 (1998)
Medline: 99000505

Power PM, Roddam LF, Dieckelmann M, Srikhanta YN, Tan YC, Berrington AW, Jennings MP.
Genetic characterization of pilin glycosylation in Neisseria meningitidis.
Microbiology. 2000 Apr;146 ( Pt 4):967-79.
PMID: 10784055


Secondary Evidence:
Klena,J.D., Ashford,R.S.II. and Schnaitman,C.A.
Role of Escherichia coli K-12 rfa genes and the rfp gene of
Shigella dysenteriae 1 rfp in generation of lipopolysaccharide core heterogeneity and attachment of O-antigen
J. Bacteriol. 174, 7297-7307 (1992)
Medline: 93054344

Bastin,D.A. and Reeves,P.R.
Sequence and analysis of the O antigen gene (rfb) cluster of
Escherichia coli O111
Gene 164 (1), 17-23 (1995)
Medline: 96060831

Gohmann,S., Manning,P.A., Alpert,C.A., Walker,M.J. and Timmis,K.N.
Lipopolysaccharide O-antigen biosynthesis in Shigella dysenteriae
serotype 1: analysis of the plasmid-carried rfp determinant
Microb. Pathog. 16 (1), 53-64 (1994)
Medline: 94335608



Comment:
For other 'pgl'genes see NG0083 (pglD),NG0084 (pglC), NG0085 (pglB), NG0207 (pglE) and NG0716 (6pgl).

Oklahoma ID: NGO.1765

Blast Summary:  PSI-Blast Search
NG1765 is 98% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 2662534.

Residues 1-376 are 96% similar to glycosyltransferase from Neisseria meningitidis group B strain MD58 (gb|AAF40674.1|).

Numerous hits in gapped BLAST to glycosyl transferase sequences,e.g.residues 2-376 are 47% similar to putative glycosyl transferase from Escherichia coli (gb|AAD46728.1|).Residues 1-374 are 44% similar to RfpB=40 kda membrane-bound galactosyl-transferase from Shigella dysenteriae, serotype 1, W30864, pGom2-1,peptide plasmid, 377 aa (gb|AAC60480.1|).Residues 3-374 are 36% similar to probable glycosyl transferase from Pseudomonas aeruginosa strain PAO1 (gb|AAG04774.1|).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0438
COG name: Glycosyltransferases I
Functional Class:  M
The phylogenetic pattern of COG0438 is AMTKYQVCEBRhUj--o---X
Number of proteins in this genome belonging to this COG is 7

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 345-376 are 93% similar to a (GLYCOSYLTRANSFERASE TRANSFERASE) protein domain (PD162301) which is seen in O87893_NEIME.

Residues 2-230 are 97% similar to a (TRANSFERASE PROTEIN GALACTOSYLTRANSFERASE) protein domain (PD006280) which is seen in O87893_NEIME.

Residues 231-266 are 91% similar to a (GLYCOSYLTRANSFERASE TRANSFERASE) protein domain (PD210384) which is seen in O87893_NEIME.

Residues 267-343 are 98% similar to a (TRANSFERASE PROTEIN GLYCOSYLTRANSFERASE SYNTHASE) protein domain (PD000172) which is seen in O87893_NEIME.



Paralogs:  Local Blast Search


NG1765 is paralogously related to NG1354 (alpha-1,2-N-acetylglucosamine transferase) (1e-09).


Pfam Summary:  Pfam Search
Residues 188 to 356 (E-value = 3e-36) place NG1765 in the Glycos_transf_1 family which is described as Glycosyl transferases group 1 (PF00534)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
33
transmembrane  
134  
150

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKIVFITTVASSIYGFRAPVIKKLIGKNHQVYAFVSEFSDNELDIIREMG
VTPVTYRSNRSGVNPFSDIKSTFLIFKALKKISPDLVFPYFAKPVIFGTF
AAKLAGVPRIVGMLEGLGFAFTPQPEGIPLKTKIIKGILIALYRIALPML
ESLIVLNPDDKDELLHQYGIKIKNIHILGGIGLDLRQYPYSEADIPDEKE
PVKFLFIGRFLKEKGIDDFIRAAEQVKGKYPDTVFTALGAIDKSRGGGGD
LERFIARDIIRFPGFVNNVSEVIKAHHIFVLPSYYREGVPRSTQEAMAVG
RAVITTDVPGCRETVADKVNGFLIEPWNPRILAEKMIYFIENRAAVRLMA
NASYAIAKDKFDAEKVDLKFLDILKA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATCGTTTTTATCACAACAGTCGCATCCAGCATTTACGGTTTCCG
CGCCCCCGTCATTAAAAAATTAATCGGCAAAAACCATCAGGTGTATGCCT
TTGTATCGGAGTTTTCCGATAATGAGTTGGACATTATCAGGGAAATGGGG
GTTACACCCGTTACCTACCGGTCAAACCGCAGCGGGGTAAACCCGTTTTC
CGATATAAAATCCACCTTCCTCATATTTAAAGCACTCAAAAAAATATCGC
CGGATTTGGTTTTCCCTTATTTCGCAAAACCCGTGATTTTCGGCACTTTT
GCCGCAAAATTGGCAGGCGTGCCCAGAATCGTCGGGATGCTGGAAGGTTT
GGGATTCGCATTTACCCCGCAGCCGGAAGGCATACCGTTAAAAACAAAAA
TAATAAAGGGCATTTTGATTGCCCTGTACCGCATTGCCCTGCCGATGTTG
GAAAGCCTGATCGTATTAAACCCCGACGACAAAGACGAGCTGCTGCATCA
ATACGGCATCAAAATAAAAAACATTCATATTTTGGGCGGAATCGGTCTGG
ATTTGCGGCAATATCCTTATTCCGAGGCGGATATTCCCGATGAAAAAGAA
CCCGTAAAATTTCTCTTTATCGGCAGATTTCTGAAAGAAAAGGGGATTGA
TGATTTTATTCGGGCGGCGGAACAGGTTAAGGGCAAATACCCCGATACGG
TTTTTACCGCTTTGGGCGCAATCGACAAATCACGCGGGGGGGGGGGAGAT
TTAGAACGCTTTATCGCCCGCGATATTATCCGTTTCCCCGGTTTTGTGAA
CAATGTTTCCGAAGTGATAAAGGCGCATCATATATTCGTATTGCCGTCTT
ATTATAGGGAAGGCGTTCCCCGAAGCACCCAGGAGGCAATGGCCGTCGGC
AGGGCGGTGATTACGACGGATGTCCCCGGATGCAGGGAAACGGTTGCCGA
CAAGGTCAACGGCTTCCTGATCGAACCTTGGAATCCCCGCATCTTGGCCG
AAAAAATGATTTATTTTATCGAAAACAGGGCTGCCGTCCGCCTGATGGCG
AATGCAAGTTATGCGATTGCCAAAGATAAATTCGATGCCGAAAAAGTCGA
TTTGAAATTTCTCGATATTTTGAAGGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy