Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1434 IGR1437 IGR1433 IGR1435 IGR1438 IGR1436 IGR1438.1 IGR1438.2 IGR1432 NG1759 NG1760 pyrD, - NG1761 uvrD, - NG1757 glnE, - NG1758 acpP, - NG1762 NG1438.1 NG1764 pglA, - NG1765 fabF, - NG1763 NG1759 NG1760 pyrD, - NG1761 uvrD, - NG1757 glnE, - NG1758 acpP, - NG1762 NG1438.1 NG1764 pglA, - NG1765 fabF, - NG1763 Type: tandem, Name:  - 82 NG1760 pyrD, - NG1761 uvrD, - NG1757 glnE, - NG1758 NG1759 acpP, - NG1762 NG1438.1 NG1764 pglA, - NG1765 fabF, - NG1763
* Calculated from Protein Sequence

Gene ID: NG1761

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrD  

Definition:
dihydroorotate oxidase / dihydroorotate dehydrogenase

Gene Start:
1724179

Gene Stop:
1723175

Gene Length:
1005

Molecular Weight*:
35808

pI*:
9.40

Net Charge*:
5.84

EC:
1.3.3.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Larsen,J.N. and Jensen,K.F.
Nucleotide sequence of the pyrD gene of Escherichia coli and characterization of the flavoprotein dihydroorotate dehydrogenase
Eur. J. Biochem. 151 (1), 59-65 (1985)
Medline: 85285014


Comment:
Oklahoma ID: NGO.1761c


For other 'pyr' genes, see NG0029 (pyrE), NG0255 (pyrC), NG0401 (pyrF), NG0589 (pyrP), NG1212 (pyrG), NG1876 (pyrI), NG1973 (pyrH).

Blast Summary:  PSI-Blast Search
Residues 1-335 are 87% similar to dihydroorotate oxidase from Neisseria meningitidis group A strain Z2491 (emb|CAB83360.1|).

Numerous hits in gapped BLAST to dihydroorotate oxidase / dihydroorotate dehydrogenase sequences,e.g.residues 1-334 are 51% similar to dihydroorotate dehydrogenase from Pseudomonas aeruginosa strain PAO1 (gb|AAG06438.1|).Residues 2-328 are 49% similar to dihydroorotate oxidase from Escherichia coli O157:H7, Escherichia coli K12 (gb|AAG55431.1|).Residues 12-333 are 39% similar to dihydroorotate oxidase from Homo sapiens (gb|AAA50163.1|).


COGS Summary:  COGS Search
BeTs to 12 clades of COG0167
COG name: Dihydroorotate dehydrogenase
Functional Class:  F
The phylogenetic pattern of COG0167 is amtkyqvCEbrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001295 (Dihydroorotate dehydrogenase) with a combined E-value of 3.6e-75.
    IPB001295A    48-59
    IPB001295B    75-98
    IPB001295C    107-116
    IPB001295D    163-177
    IPB001295E    210-220
    IPB001295F    227-245
    IPB001295G    258-271
    IPB001295H    287-317
    IPB001295G    261-274


ProDom Summary:  Protein Domain Search
Residues 209-331 are 50% similar to a (DEHYDROGENASE OXIDOREDUCTASE FLAVOPROTEIN) protein domain (PD001761) which is seen in PYRD_HAEIN.

Residues 126-182 are 64% similar to a (DIHYDROOROTATE DEHYDROGENASE) protein domain (PD123507) which is seen in PYRD_SALTY.

Residues 44-118 are 68% similar to a (DIHYDROOROTATE DEHYDROGENASE) protein domain (PD005859) which is seen in PYRD_SALTY.



Paralogs:  Local Blast Search


NG1761 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 43 to 335 (E-value = 1.7e-123) place NG1761 in the DHO_dh family which is described as Dihydroorotate dehydrogenase (PF01180)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
180  
241

PDB Hit:
pdb|1F76|1F76-A ESCHERICHIA COLI DIHYDROOROTATE DEHYDROGENASE 331.0 1e-91
pdb|1D3G|1D3G-A HUMAN DIHYDROOROTATE DEHYDROGENASE COMPLEXED 230.0 2e-61
pdb|1EP1|1EP1-A CRYSTAL STRUCTURE OF LACTOCOCCUS LACTIS 82.7 9e-17
pdb|1DOR|1DOR-A DIHY

Gene Protein Sequence:
MYPLARRILFALDAEKAHHFTLDALNTVYKLGLIPVTDNRTKPIKLMGMD
LPNPVGLAAGLDKNGEYIDALGALGFGFLEIGTVTRNPQPGNPQPRLFRV
PEHQGIINRMGFNNHGIDAMIRNIEKSKYQGVLGINIGKNAVTPIQNAAD
DYLICLEKAYAHASYITVNISSPNTKNLRALQGGGELGALLEALKNKQAQ
LAAAHGKYIPLAVKIAPDLDEAQIEDIARVVKSVEMDGIIATNTTIDKSS
LGSHPLAGEQGGLSGFPVREKSNRVLKKLAEHIDGALPIIGVGGIMEGGD
AAEKIRLGTTAVQVYSGLIYKGPALVKECLKALAR

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATCCACTTGCCCGCCGCATCCTGTTTGCACTCGATGCCGAAAAAGC
CCACCACTTCACGCTCGACGCGCTCAACACGGTTTATAAATTGGGCCTGA
TTCCCGTAACCGACAACCGTACCAAACCTATAAAACTGATGGGTATGGAT
TTGCCCAACCCTGTCGGGCTTGCCGCAGGTCTCGACAAAAACGGTGAATA
CATCGACGCTTTGGGCGCGCTCGGTTTCGGCTTCCTCGAAATCGGCACGG
TTACGCGCAACCCGCAGCCCGGCAACCCGCAGCCGCGCCTCTTCCGCGTT
CCCGAACACCAAGGCATCATCAACCGAATGGGTTTTAACAACCACGGCAT
CGACGCGATGATACGCAATATTGAAAAAAGCAAATATCAAGGCGTATTGG
GCATCAACATCGGCAAAAACGCGGTTACGCCCATCCAAAACGCCGCCGAT
GATTATTTAATCTGCCTCGAAAAAGCCTACGCGCACGCAAGCTACATTAC
CGTCAACATTTCCTCGCCCAACACCAAAAACCTCCGCGCGCTGCAAGGCG
GCGGCGAATTGGGCGCATTGCTCGAAGCCCTGAAAAACAAACAGGCGCAG
CTTGCCGCCGCCCACGGCAAATATATCCCGCTAGCCGTCAAAATCGCCCC
CGATTTGGATGAAGCACAAATCGAAGACATCGCCCGCGTCGTCAAATCCG
TCGAAATGGACGGCATCATCGCTACCAACACCACCATCGACAAATCAAGC
CTCGGCAGCCATCCGCTCGCAGGCGAGCAGGGCGGTTTGAGCGGTTTTCC
CGTGCGCGAAAAAAGCAACCGGGTGCTGAAAAAACTGGCGGAACACATAG
ACGGCGCATTGCCGATTATCGGCGTAGGCGGCATTATGGAAGGCGGGGAC
GCGGCAGAGAAAATCCGCTTGGGCACGACCGCCGTCCAAGTGTACAGCGG
ATTGATATACAAAGGCCCGGCGTTGGTCAAAGAATGTTTGAAGGCATTGG
CGCGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy