Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1434 IGR1431 IGR1437 IGR1429 IGR1433 IGR1435 IGR1436 IGR1430 IGR1432 NG1755 NG1756 NG1759 NG1760 pyrD, - NG1761 uvrD, - NG1757 glnE, - NG1758 acpP, - NG1762 fabF, - NG1763 NG1755 NG1756 NG1759 NG1760 pyrD, - NG1761 uvrD, - NG1757 glnE, - NG1758 acpP, - NG1762 fabF, - NG1763 NG1756 NG1760 pyrD, - NG1761 uvrD, - NG1757 glnE, - NG1758 NG1755 NG1759 acpP, - NG1762 fabF, - NG1763
* Calculated from Protein Sequence

Gene ID: NG1758

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glnE  

Definition:
probable glutamate-ammonia-ligase adenylyltransferase

Gene Start:
1721959

Gene Stop:
1719272

Gene Length:
2688

Molecular Weight*:
101726

pI*:
5.70

Net Charge*:
-16.11

EC:
2.7.7.42  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
van Heeswijk,W.C., Rabenberg,M., Westerhoff,H.V. and Kahn,D.
The genes of the glutamine synthetase adenylylation cascade are not regulated by nitrogen in Escherichia coli
Mol. Microbiol. 9 (3), 443-457 (1993)
Medline: 94018640


Comment:
Oklahoma ID: NGO.1758c

For other 'gln' genes, see NG0269 (glnQ), NG0374 (glnQ), NG0798 (glnD), NG1182 (glnB), NG1218 (glnS), NG1600 (glnA), NG2011
(glnM), NG2013 (glnQ), NG2012 (glnP).

Blast Summary:  PSI-Blast Search
Residues 1-896 are 90% similar to probable glutamate-ammonia-ligase adenylyltransferase from Neisseria meningitidis group A strain Z2491 (emb|CAB83353.1|).

Numerous hits in gapped BLAST to glutamate-ammonia-ligase adenylyltransferase sequences,e.g.residues 75-888 are 39% similar to glutamate-ammonia-ligase adenylyltransferase from Pseudomonas aeruginosa strain PAO1 (gb|AAG08399.1|).Residues 90-892 are 36% similar to glutamate-ammonia-ligase adenylyltransferase from Escherichia coli K12 (1789433|).Residues 118-890 are 36% similar to glutamate-ammonia-ligase adenylyltransferase VC2438 from Vibrio cholerae group O1 strain N16961 (gb|AAF95580.1|).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1391
COG name: Glutamine synthetase adenylyltransferase GlnE
Functional Class:  O,T
The phylogenetic pattern of COG1391 is -----q--e-rh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 303-519 are 30% similar to a (GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE GLUTAMINE-) protein domain (PD044013) which is seen in GLNE_ECOLI.

Residues 306-831 are 25% similar to a (GLUTAMATE AMMONIA LIGASE) protein domain (PD147866) which is seen in O67651_AQUAE.

Residues 525-669 are 38% similar to a (ADENYLYLTRANSFERASE ATASE TRANSFERASE REPEAT GLUTAMINE-) protein domain (PD011929) which is seen in GLNE_HAEIN.

Residues 682-810 are 45% similar to a (TRANSFERASE GLUTAMATE-AMMONIA-LIGASE) protein domain (PD008864) which is seen in GLNE_HAEIN.



Paralogs:  Local Blast Search


NG1758 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 57 to 273 (E-value = 3.2e-63) place NG1758 in the GlnE family which is described as Glutamate-ammonia ligase adenylyltransferase (PF03710)
Residues 575 to 779 (E-value = 3.4e-111) place NG1758 in the GlnE family which is described as Glutamate-ammonia ligase adenylyltransferase (PF03710)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
34  
108

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSDHRLDTARRHSLFLARQLDNGKLKPEIFLPMLDKALTDEGFQAFADWD
KIRAEESEEELARQLRELRRYVVSQIIVRDINRISDLNEVTRTITLFADF
AVNTALDFAYAYYRDMYGTPIGRYTKSPQHLSVVAMGKAGGYELNVSSDI
DLIFVYPESGDTDGRRERGNQEFFTKVGQKLIALLNGITADGQVFRVDMR
LRPDGDSGALVLSETVLEQYLITQGREWERYAWCKGRVVTPYPNDIKSLV
RPFVFRKYLDYGAYEAMRNLHRQIRSEVSKKGMADNIKLGAGGIREVEFI
AQIFQMIRGGQMRALQLKGTQETLKKIAEMGIMPSENVETLLAAYRFLRD
VEHRLQYWDDRQTQTLPISPEQRQLLAESMGFDSYAAFSDGLNVHRNKVN
QLFNEILSEPEEQAQSNSEWQWAWQEKPDEEERLGRLKEHGFDAEAVTAR
LEQICHGHKYRRLSAHAQPRFDTIVPLFVQAAAEQNNPTDTLMRLLDFLE
NISLRSAYLAFLNEHPQTLAQLAQIMSQSSWVAAYLNKYPILLDELISAQ
LLDTAFDWQALAAALSDGIEACGGDTEAQMDTLRHFQHAQVFRLAVQDLA
GLWTVESLSDQLSALADTVIAAALSCAWADMPKKHRDTPQFAVIGYGKLG
GKELGYASDLDLVYLYDDPHPEAGDVYSRLARRLTNRLSAATGAGSLYET
DLRLRPNGDAGFLAHSIAAFGKYQRENAWTWEHQSLTRARFICGTPEIQT
AFDRIRTEMLTAERDQTALAGEIIEMREKMFPTHPPADSNVKYARGGVVD
VEFIVQYLILAHARQYPQLLDNYGNIALLNIAADCGLIDKTLAGQSRTAY
RLYRRQQHNTKLRDAAKTEVSDELLSHYGNVRKLWREVFGEEAATA

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGACCACCGCCTCGACACCGCCCGCCGCCATTCCCTGTTCCTCGC
CCGCCAGCTCGACAACGGCAAACTCAAGCCCGAAATTTTCCTGCCCATGT
TGGACAAGGCGTTGACGGATGAGGGTTTCCAAGCCTTTGCCGACTGGGAC
AAAATCCGCGCGGAAGAAAGCGAGGAAGAATTGGCGCGGCAGTTGCGCGA
GTTGCGCCGTTATGTGGTGTCGCAGATTATCGTGCGCGATATAAACCGCA
TCAGCGATTTGAACGAAGTTACCCGCACGATTACGCTGTTTGCCGATTTT
GCCGTCAATACCGCGCTGGATTTCGCCTACGCCTATTATCGGGACATGTA
CGGCACGCCGATCGGGCGTTATACCAAATCGCCGCAGCATTTGAGCGTGG
TGGCGATGGGCAAGGCGGGCGGCTATGAGTTGAACGTGTCTTCCGACATC
GATTTGATTTTCGTCTATCCCGAATCGGGCGACACCGACGGCAGGCGCGA
ACGGGGGAATCAGGAGTTTTTCACCAAAGTCGGGCAGAAACTGATTGCAT
TGTTGAACGGCATTACTGCCGACGGGCAGGTGTTCCGCGTCGATATGCGG
CTGCGGCCGGACGGTGATTCGGGCGCGTTGGTATTGAGCGAAACCGTGCT
GGAGCAATATCTGATTACGCAGGGGCGCGAATGGGAACGCTATGCGTGGT
GCAAAGGCCGCGTAGTCACGCCGTATCCGAACGACATCAAATCGCTGGTG
CGCCCCTTCGTGTTCCGCAAATATCTGGATTACGGCGCGTATGAGGCGAT
GCGCAACCTGCACCGCCAAATCCGCAGCGAAGTCAGCAAAAAAGGCATGG
CGGACAACATCAAACTCGGCGCGGGCGGCATCCGCGAGGTTGAATTTATC
GCCCAGATTTTCCAGATGATACGCGGCGGCCAAATGCGCGCGCTGCAACT
GAAAGGCACGCAGGAAACGCTGAAGAAAATTGCCGAGATGGGCATTATGC
CGTCTGAAAACGTCGAAACCCTGCTTGCCGCCTACCGCTTCCTGCGCGAT
GTCGAACACCGCCTGCAATACTGGGACGACCGGCAAACCCAAACCCTGCC
GATCTCGCCCGAACAGCGGCAACTGCTCGCCGAAAGCATGGGTTTCGACA
GTTATGCCGCTTTTTCAGACGGCCTCAATGTTCATCGGAACAAAGTCAAT
CAGTTGTTCAACGAAATCTTGAGCGAACCTGAAGAACAAGCGCAAAGCAA
TAGCGAATGGCAATGGGCATGGCAGGAAAAACCCGACGAAGAAGAACGGC
TAGGCCGTCTGAAAGAACACGGGTTCGATGCCGAAGCCGTCACCGCAAGG
CTCGAACAAATCTGCCACGGACATAAATACCGCCGCCTTTCCGCACACGC
CCAGCCGCGCTTTGACACCATTGTGCCGCTGTTTGTACAGGCGGCGGCAG
AGCAAAACAACCCGACAGATACGCTGATGCGGCTGTTGGATTTTCTCGAA
AACATCAGCCTCCGCTCCGCCTATCTCGCCTTCCTCAACGAACATCCGCA
AACCTTGGCACAACTGGCGCAGATTATGAGCCAAAGCTCGTGGGTGGCGG
CGTATCTGAACAAATATCCGATTTTGTTGGACGAACTCATCAGCGCGCAG
CTTTTGGATACCGCGTTTGATTGGCAGGCACTCGCCGCCGCCCTTTCAGA
CGGCATCGAAGCCTGCGGCGGCGATACCGAAGCGCAAATGGACACGCTGC
GCCATTTCCAACACGCCCAAGTCTTCCGCCTCGCCGTCCAAGACCTCGCC
GGATTGTGGACGGTAGAATCCCTCTCTGACCAACTCTCCGCCCTCGCCGA
CACCGTCATTGCCGCCGCCCTTTCGTGCGCGTGGGCGGATATGCCCAAAA
AACACCGCGACACCCCGCAATTCGCCGTCATCGGCTACGGCAAGCTCGGC
GGCAAAGAACTCGGCTACGCCTCCGACCTCGACTTAGTCTATCTTTACGA
CGATCCCCATCCCGAAGCAGGCGACGTGTACAGCCGCCTCGCCCGCCGCC
TGACCAACCGGCTTTCCGCCGCCACCGGCGCGGGCAGCCTCTACGAAACC
GACCTGCGCCTGCGCCCTAATGGCGACGCCGGTTTCCTCGCGCACAGCAT
CGCCGCCTTTGGAAAATACCAGCGTGAAAACGCATGGACATGGGAACACC
AGTCCCTCACCCGCGCCCGCTTCATCTGCGGCACACCCGAAATTCAGACG
GCATTCGACCGCATCCGCACCGAAATGCTGACTGCCGAACGCGACCAAAC
CGCCTTGGCAGGCGAAATCATCGAAATGCGCGAAAAAATGTTCCCCACCC
ATCCGCCTGCCGACAGCAACGTCAAATACGCGCGCGGCGGCGTGGTCGAC
GTCGAATTTATCGTCCAATATCTGATACTTGCCCATGCCCGCCAGTATCC
GCAACTCTTGGACAACTACGGCAACATCGCCCTATTGAACATCGCCGCCG
ACTGCGGTTTGATTGACAAAACCCTCGCCGGACAAAGCCGCACCGCCTAC
CGCCTCTACCGCCGGCAGCAGCACAACACCAAATTGCGCGACGCGGCAAA
AACCGAAGTAAGCGACGAATTGCTGTCCCATTACGGCAATGTCAGGAAAT
TGTGGCGGGAAGTGTTCGGGGAGGAAGCGGCAACCGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy