Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1434 IGR1431 IGR1429 IGR1433 IGR1428 IGR1430 IGR1432 IGR1427 NG1755 NG1756 NG1759 mafI, - NG1754 NG1760 NG1752 uvrD, - NG1757 glnE, - NG1758 NG1755 NG1756 NG1759 mafI, - NG1754 NG1760 NG1752 uvrD, - NG1757 glnE, - NG1758 Type: tandem, Name:  - 81 Type: inverse, Name:  - 177 NG1756 mafI, - NG1754 NG1760 NG1752 uvrD, - NG1757 glnE, - NG1758 NG1753 NG1753 NG1755 NG1759
* Calculated from Protein Sequence

Gene ID: NG1757

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
uvrD  

Definition:
probable DNA helicase II

Gene Start:
1718845

Gene Stop:
1716641

Gene Length:
2205

Molecular Weight*:
82110

pI*:
6.60

Net Charge*:
-3.26

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Secondary Evidence:
Easton,A.M. and Kushner,S.R.
Transcription of the uvrD gene of Escherichia coli is controlled by the lexA repressor and by attenuation.
Nucleic Acids Res. 11 (24), 8625-8640 (1983)
Medline: 84169504

Finch,P.W. and Emmerson,P.T.
The nucleotide sequence of the uvrD gene of E. coli
Nucleic Acids Res. 12 (14), 5789-5799 (1984)
Medline: 84272253

Yamamoto,Y., Ogawa,T., Shinagawa,H., Nakayama,T., Matsuo,H. and
Ogawa,H.
Determination of the initiation sites of transcription and
translation of the uvrD gene of Escherichia coli
J. Biochem. 99 (6), 1579-1590 (1986)
Medline: 86304220


Colloms,S.D., Sykora,P., Szatmari,G. and Sherratt,D.J.
Recombination at ColE1 cer requires the Escherichia coli xerC gene
product, a member of the lambda integrase family of site-specific
recombinases
J. Bacteriol. 172 (12), 6973-6980 (1990)
Medline: 91072248



Comment:
For other 'uvr'genes see NG0573 (uvrB) and NG1207 (uvrA).

Oklahoma ID: NGO.1757c

Blast Summary:  PSI-Blast Search
Residues 1-735 are 93% similar to DNA helicase II from Neisseria meningitidis group B strain MD58 (gb|AAF40687.1|).

Numerous hits in gapped BLAST to DNA helicase II sequences,e.g. residues 10-735 are 46% similar to DNA-dependent ATPase I and helicase II from Escherichia coli K12 (gb|AAC76816.1|).Residues 10-735 are 45% similar to DNA helicase II / mismatch repair protein MutU from Pseudomonas aeruginosa (gb|AAG08828.1|).Residues 10-646 are 33% similar to rep helicase, single-stranded DNA-dependent ATPase (rep) from syphilis spirochete,Treponema pallidum (gb|AAC65097.1|).Residues 10-649 are 33% similar to DNA helicase from Chlamydia trachomatis serotype D, strain UW3/Cx (gb|AAC68211.1|).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0210
COG name: Superfamily I DNA and RNA helicases
Functional Class:  L
The phylogenetic pattern of COG0210 is --T-YqvCEBRHUJgPOLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000212 (UvrD/REP helicase) with a combined E-value of 1.3e-73.
    IPB000212A    33-43
    IPB000212B    61-78
    IPB000212C    222-233
    IPB000212D    249-262
    IPB000212E    282-300
    IPB000212F    559-577
    IPB000212G    599-611


ProDom Summary:  Protein Domain Search
Residues 683-735 are 45% similar to a (HELICASE DNA II ATP-BINDING) protein domain (PD011354) which is seen in UVRD_ECOLI.

Residues 527-644 are 49% similar to a (HELICASE DNA ATP-BINDING DNA-BINDING II ATP-DEPENDENT) protein domain (PD002094) which is seen in UVRD_ECOLI.

Residues 14-135 are 61% similar to a (HELICASE PROTEIN ATP-BINDING DNA DNA-BINDING) protein domain (PD000627) which is seen in O31089_SERMA.

Residues 347-429 are 67% similar to a (HELICASE DNA ATP-BINDING DNA-BINDING II ATP-DEPENDENT) protein domain (PD003735) which is seen in UVRD_HAEIN.

Residues 134-338 are 48% similar to a (HELICASE DNA ATP-BINDING DNA-BINDING ATP-DEPENDENT) protein domain (PD001658) which is seen in UVRD_ECOLI.

Residues 352-442 are 41% similar to a (PROTEIN ORF PUTATIVE KINASE) protein domain (PD000146) which is seen in REP_BUCAP.



Paralogs:  Local Blast Search


NG1757 is paralogously related to NG0739 (ATP-dependent DNA helicase) (5e-96) and NG0370 (exodeoxyribonuclease V beta chain (DNA helicase, ATP-dependent dsDNA/ssDNA exonuclease V subunit, ssDNA endonuclease)) (1e-10).


Pfam Summary:  Pfam Search
Residues 14 to 486 (E-value = 1.9e-186) place NG1757 in the UvrD-helicase family which is described as UvrD/REP helicase (PF00580)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
496  
552

PDB Hit:
pdb|1QHG|1QHG-A 443.0 0e+00
pdb|2PJR|2PJR-A HELICASE PRODUCT COMPLEX 347.0 3e-96
pdb|1UAA|1UAA-A STRUCTURE OF THE REP HELICASE-SINGLE STRANDED 339.0 8e-94
pdb|1QHH|1QHH-B STRUCTURE OF DNA HELICASE WITH ADPNP 21

Gene Protein Sequence:
MFPDQSAPNLLQGLNPEQLSAVTWPPQSALVLAGAGSGKTRVLTTRIAWL
LQSGQASVHSIMAVTFTNKAAKEMQTRLGAMIPINVRAMWLGTFHGLCHR
FLRLHHRDAGLPSSFQILDSGDQLSLIKRLLKSLNIAEEIIAPRSLQGFI
NAQKESGLRASVLGAPDPHTSRMIGCYAEYDKICQREGVVDFAELMLRSY
EMLQSNEILRRHYQNRFNHILVDEFQDTNKLQYAWLKLMAGGNAAVFAVG
DDDQSIYRFRGANVGNMTALMEEFHIDAPVKLEQNYRSVGNILAAANAVI
ENNDERLGKNLRTDAEAGDKIRYYSAFTDLEEARFIVDETKALEREGWDL
DEIAVLYRSNAQSRVIEQSLFRSGIPYKIYGGLRFYERQEIKHALAYLRL
AVNPDDDNALLRVINFPPRGIGARTVENLQTASNEQGITLWQAACNAGAK
AAKVVAFVRLIEALRNQVGQMHLSEIIVGILKDSGLTEHYRTQKGDNQDR
LDNLDELVNAAIEFKPEDSNFETLPENISDDPAFPILAFLSNAALESGEN
QAGAGEKAVQLMTVHAAKGLEFNAVFLTGMEEGRFPSEMSLAERGGLEEE
RRLMYVAITRARKRLYITMAQQRMLHGQTQFGIASRFVEEIPPEVLHYLS
VKKPAFDSYGNTRQTTVQRDKIIDDFKQPQTYAGFRIGQNVRHAKFGTGV
IIDAADKGESARLTINFGKQGVKELDTKFAKLEAM

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTCCCGACCAATCCGCCCCCAATCTGCTGCAAGGCTTGAACCCCGA
ACAACTCTCCGCCGTAACCTGGCCGCCGCAATCCGCCCTCGTTTTGGCAG
GCGCAGGCAGCGGCAAAACGCGCGTGCTGACCACGCGTATCGCATGGCTT
TTGCAAAGCGGACAAGCCAGCGTACACAGCATTATGGCGGTAACGTTTAC
CAACAAGGCCGCCAAAGAGATGCAAACCCGACTCGGCGCAATGATTCCCA
TCAACGTCCGCGCTATGTGGCTCGGCACGTTCCACGGTTTGTGCCACCGC
TTTTTGCGCCTGCACCACCGCGACGCAGGCCTGCCGTCTTCCTTTCAAAT
CCTCGACAGCGGCGACCAGCTTTCCCTCATCAAACGCCTGCTCAAAAGCC
TCAACATCGCCGAAGAAATCATCGCGCCGCGTTCGCTGCAAGGCTTTATC
AACGCGCAAAAAGAATCCGGTTTGCGCGCTTCCGTCTTGGGCGCGCCCGA
TCCGCACACAAGCCGCATGATTGGGTGCTACGCCGAATACGACAAAATCT
GCCAACGCGAAGGCGTGGTCGATTTCGCCGAACTCATGCTCCGCAGCTAC
GAAATGCTGCAAAGTAACGAAATCCTGCGCCGGCACTACCAAAACCGCTT
CAACCACATTCTGGTCGACGAGTTTCAAGACACCAACAAACTGCAATACG
CCTGGCTCAAACTCATGGCGGGCGGTAACGCAGCGGTATTTGCCGTCGGC
GACGACGACCAAAGCATTTACCGCTTCCGCGGCGCAAACGTCGGCAACAT
GACCGCACTGATGGAAGAATTCCACATCGACGCGCCCGTCAAACTCGAAC
AAAACTACCGCTCCGTCGGCAACATCCTCGCCGCCGCCAACGCCGTTATC
GAAAACAACGACGAACGTCTCGGCAAAAACCTGCGCACCGACGCCGAAGC
AGGCGACAAAATCCGCTACTACTCCGCCTTTACCGACCTCGAAGAAGCCC
GGTTCATCGTGGATGAAACCAAAGCCCTCGAACGCGAAGGCTGGGATTTG
GACGAAATCGCCGTCCTCTACCGCAGCAACGCCCAATCGCGCGTCATCGA
ACAAAGCCTGTTCCGCAGCGGCATCCCCTACAAAATCTACGGCGGCCTGC
GCTTTTACGAACGCCAAGAAATCAAACACGCCCTCGCCTACCTGCGCCTC
GCCGTCAATCCCGACGACGACAACGCCCTCTTGCGTGTCATCAACTTCCC
ACCGCGCGGCATCGGCGCGCGCACCGTCGAAAACCTTCAGACGGCCTCAA
ACGAACAAGGCATCACCCTCTGGCAGGCAGCCTGCAACGCCGGCGCGAAA
GCCGCCAAAGTCGTCGCCTTCGTCCGCCTGATTGAAGCCCTGCGCAACCA
AGTCGGACAAATGCACCTGTCCGAAATCATCGTCGGCATCCTCAAAGACA
GCGGTCTGACCGAGCACTACCGAACCCAAAAAGGCGACAACCAAGACCGC
CTCGACAACCTTGACGAACTCGTCAACGCCGCCATCGAGTTCAAACCCGA
AGACAGCAACTTTGAAACCCTGCCCGAAAACATTTCAGACGATCCCGCCT
TCCCCATCCTCGCCTTCTTGAGCAACGCCGCCCTCGAATCCGGCGAAAAC
CAAGCAGGGGCAGGCGAAAAAGCCGTCCAACTGATGACCGTCCACGCCGC
CAAAGGCTTGGAATTCAACGCCGTCTTCCTCACCGGTATGGAAGAGGGGC
GTTTCCCCAGCGAAATGAGCCTTGCCGAGCGCGGCGGCCTCGAAGAAGAA
CGCCGCCTCATGTACGTCGCCATCACCCGCGCCCGCAAACGCCTCTACAT
CACCATGGCACAGCAACGCATGCTGCACGGACAAACCCAATTCGGCATCG
CATCCCGCTTCGTCGAAGAAATCCCGCCAGAAGTATTGCACTACCTGTCC
GTCAAAAAACCCGCCTTCGACAGCTACGGCAACACGCGCCAAACCACCGT
ACAACGGGACAAAATCATCGATGACTTCAAACAGCCGCAAACCTACGCAG
GCTTCCGCATCGGACAAAACGTCCGTCACGCCAAATTCGGCACCGGCGTG
ATTATCGATGCCGCAGACAAAGGCGAATCCGCCCGACTGACCATCAACTT
CGGCAAACAGGGCGTGAAAGAGCTGGATACCAAGTTTGCGAAATTGGAAG
CGATG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy