Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1423.1 IGR1425 IGR1426 IGR1431 IGR1429 IGR1428 IGR1430 IGR1424 IGR1423 IGR1427 NG1755 NG1745.1 NG1756 mafI, - NG1754 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 uvrD, - NG1757 NG1755 NG1745.1 NG1756 mafI, - NG1754 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 uvrD, - NG1757 Type: tandem, Name:  - 81 Type: inverse, Name:  - 177 NG1756 mafI, - NG1754 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 uvrD, - NG1757 nuoA, - NG1751 nuoC,nuoD, - NG1749 NG1753 nuoC,nuoD, - NG1749 NG1753 nuoA, - NG1751 NG1755 NG1745.1
* Calculated from Protein Sequence

Gene ID: NG1751

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoA  

Definition:
NADH-ubiquinone oxidoreductase subunit 3 (chain A)

Gene Start:
1712313

Gene Stop:
1711960

Gene Length:
354

Molecular Weight*:
13627

pI*:
5.20

Net Charge*:
-1.82

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Xu,X., Matsuno-Yagi,A. and Yagi,T.
Gene cluster of the energy-transducing NADH-quinone oxidoreductas of Paracoccus denitrificans: Characterization of four structural gene products.
Biochemistry 31, 6925-6932 (1992) [Medline: 92345253].

Weidner,U., Geier,S., Ptock,A., Friedrich,T., Leif,H. and Weiss,H. The gene locus of the proton-translocating NADH: ubiquinone oxidoreductase in Escherichia coli.
Organization of the 14 genesand relationship between the derived proteins and subunits ofmitochondrial complex I. J. Mol. Biol. 233 (1): 109-122 (1993) [Medline: 93389724].

Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1741 (nuoK),NG1742(nuoJ),NG1743 (nuoI),NG1744 (nuoH),NG1745 (nuoG),
NG1746 (nuoF),NG1747 (nuoE),NG1748 (nuoD nuoC),NG1749 (nuoD nuoC),NG1750(nuoB),NG1737 (nuoN).


Oklahoma ID: NGO.1751c

Blast Summary:  PSI-Blast Search
Residues 1-118 are 97% similar to NADH dehydrogenase I chain A from Neisseria meningitidis group A strain Z2491 (emb|CAB83339.1|)

Numerous hits in gapped BLAST to NADH dehydrogenase I chain A / NADH-ubiquinone oxidoreductase sequences,e.g.residues 1-118 are 55% similar to NADH-ubiquinone dehydrogenase chain A 1 from Mesorhizobium loti (14022149|).Residues 6-117 are 32% similar to NADH dehydrogenase I chain A from Escherichia coli O157:H7 (13362642|). Residues 6-117 are 34% similar o NADH dehydrogenase I chain A from Pseudomonas aeruginosa strain PAO1 (gb|AAG06025.1|).

COGS Summary:  COGS Search
BeTs to 6 clades of COG0838
COG name: NADH-ubiquinone oxidoreductase subunit 3 (chain A), NuoA/NQO7/NdhC
Functional Class:  C
The phylogenetic pattern of COG0838 is -----Q-ce-r-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000440 (NADH-ubiquinone/plastoquinone oxidoreductase, chain 3) with a combined E-value of 6.8e-30.
    IPB000440A    37-72
    IPB000440B    98-117


ProDom Summary:  Protein Domain Search
Residues 71-117 are 76% similar to a (MITOCHONDRION OXIDOREDUCTASE CHAIN DEHYDROGENASE) protein domain (PD001357) which is seen in O68852_BBBBB.

Residues 92-117 are 84% similar to a (MITOCHONDRION DEHYDROGENASE SUBUNIT NADH) protein domain (PD000584) which is seen in O84969_RHOCA.

Residues 29-69 are 56% similar to a (MITOCHONDRION DEHYDROGENASE NADH) protein domain (PD000308) which is seen in Q9ZDH1_RICPR.



Paralogs:  Local Blast Search


NG1751 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 37 to 117 (E-value = 3.6e-41) place NG1751 in the Oxidored_q4 family which is described as NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 (PF00507)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
20
transmembrane  
8  
24
transmembrane  
62  
78
transmembrane  
91  
107

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYKCGFESFE
NARMKFDVRYYLVDILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIV
VLTVGFVYEWKKGALEWE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGTCCGCTTATTTTCCCGTCTTTGTCTTTATCCTCGTCGGCCTCGC
GGCCGGCGTACTGTTTATCCTGCTCGGCACGATTTTGGGCCCGAAACGCC
ACTATGCCGAAAAAGACGCGCCTTACAAATGCGGTTTTGAATCCTTTGAA
AACGCAAGGATGAAGTTCGACGTGCGCTATTACCTCGTCGACATCCTGTT
CATCCTCTTCGATTTGGAGGTTGCGTTTATGCTGCCGTGGGCAGTCGTGT
TCAAAGATTTGGGCGCGTACGGCTTTTGGTCTATGCTGGTGTTTATCGTC
GTCCTGACGGTAGGCTTTGTTTACGAATGGAAAAAAGGTGCGCTGGAATG
GGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy