Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1423.1 IGR1425 IGR1426 IGR1431 IGR1429 IGR1428 IGR1430 IGR1424 IGR1423 IGR1427 NG1755 NG1745.1 NG1756 mafI, - NG1754 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 uvrD, - NG1757 nuoG, - NG1745 NG1755 NG1745.1 NG1756 mafI, - NG1754 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 uvrD, - NG1757 nuoG, - NG1745 Type: tandem, Name:  - 81 Type: inverse, Name:  - 177 mafI, - NG1754 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 uvrD, - NG1757 nuoG, - NG1745 nuoA, - NG1751 nuoC,nuoD, - NG1749 NG1753 nuoC,nuoD, - NG1749 NG1753 nuoA, - NG1751 NG1745.1 NG1756 NG1755
* Calculated from Protein Sequence

Gene ID: NG1750

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoB  

Definition:
NADH dehydrogenase I chain B / NADH-ubiquinone oxidoreductase

Gene Start:
1711987

Gene Stop:
1711487

Gene Length:
501

Molecular Weight*:
18364

pI*:
9.00

Net Charge*:
5.47

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Heiser,V., Brennicke,A. and Grohmann,L.
The plant mitochondrial 22 kDa (PSST) subunit of respiratory chain
complex I is encoded by a nuclear gene with enhanced transcript
levels in flowers.
Plant Mol. Biol. 31 (6),1195-1204 (1996)
Medline: 97071689

Xu,X., Matsuno-Yagi,A. and Yagi,T.
Gene cluster of the energy-transducing NADH-quinone oxidoreductas
of Paracoccus denitrificans: Characterization of four structural
gene products.
Biochemistry 31, 6925-6932 (1992)
Medline: 92345253

Weidner,U., Geier,S., Ptock,A., Friedrich,T., Leif,H. and Weiss,H.
The gene locus of the proton-translocating NADH: ubiquinone
oxidoreductase in Escherichia coli. Organization of the 14 genes
and relationship between the derived proteins and subunits of
mitochondrial complex I.
J. Mol. Biol. 233 (1), 109-122 (1993)
Medline: 93389724

Leif,H., Sled,V.D., Ohnishi,T., Weiss,H. and Friedrich,T.
Isolation and characterization of the proton-translocating NADH:
ubiquinone oxidoreductase from Escherichia coli
Eur. J. Biochem. 230 (2), 538-548 (1995)
Medline: 95331291





Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1741 (nuoK),NG1742(nuoJ),NG1743 (nuoI),NG1744 (nuoH),NG1745 (nuoG),
NG1746 (nuoF),NG1747 (nuoE),NG1748 (nuoD nuoC),NG1749 (nuoD nuoC),NG1737(nuoN),NG1751 (nuoA).



Oklahoma ID: NGO.1750c



Blast Summary:  PSI-Blast Search
Residues 8-167 are 90% similar to NADH dehydrogenase I chain B from Neisseria meningitidis group B strain MD58 (gb|AAF40696.1|).

Numerous hits in gapped BLAST to NADH dehydrogenase I chain B / NADH-ubiquinone oxidoreductase sequences,e.g.residues 9-164 are 67% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa strain 9a5c (gb|AAF83117.1|).Residues 18-159 are 64% similar to NADH dehydrogenase (ubiquinone) Fe-S protein 7 (NADH-coenzyme Q reductase) from Homo sapiens (gb|AAH01715.1|).Residues 10-157 are 47% similar to Pseudomonas
aeruginosa strain PAO1 (gb|AAG06026.1|).Residues 10-157 are 45% similar to NADH dehydrogenase I chain B from Escherichia coli O157:H7 (gb|AAG57416.1|).


COGS Summary:  COGS Search
BeTs to 11 clades of COG0377
COG name: NADH:ubiquinone oxidoreductase 20 kD subunit NuoB/Nqo6/NdhK and related Fe-S oxidoreductases
Functional Class:  C
The phylogenetic pattern of COG0377 is aMTK-qvcE-R-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002096 (Respiratory-chain NADH dehydrogenase 20 Kd subunit) with a combined E-value of 8.5e-65.
    IPB002096A    29-79
    IPB002096B    112-157


ProDom Summary:  Protein Domain Search
Residues 47-159 are 73% similar to a (SUBUNIT OXIDOREDUCTASE HYDROGENASE IRON-SULFUR SMALL) protein domain (PD000758) which is seen in O21272_RECAM.



Paralogs:  Local Blast Search


NG1750 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 47 to 154 (E-value = 5.2e-61) place NG1750 in the Oxidored_q6 family which is described as NADH ubiquinone oxidoreductase, 20 Kd subunit (PF01058)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MEKRCAGMGIEGVLKKGFITTSADTVLNHMRTGSLWPVTFGLACCAVEMM
HAGMARYDLDRFGIIFRPSPRQADLMIVAGTLTNKMAPALRRVYDQLAEP
RWVLSMGSCANGGGYYHYSYSVVRGADRVVPVDVYVPGCPPTAEALIYGL
IQLQQKIKRTSTIARDE

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAAAGGTGCGCTGGAATGGGAATAGAAGGCGTTTTGAAAAAAGG
TTTCATCACCACCAGCGCGGATACGGTGTTGAACCATATGCGTACCGGTT
CATTGTGGCCGGTTACTTTCGGATTGGCCTGCTGCGCCGTGGAAATGATG
CATGCGGGTATGGCGCGTTATGACCTTGACCGTTTCGGTATCATTTTCCG
TCCGTCCCCACGTCAGGCCGACCTGATGATTGTGGCAGGTACGCTGACCA
ATAAAATGGCGCCAGCCCTGCGTCGCGTGTACGACCAGCTCGCCGAGCCG
CGCTGGGTATTGTCTATGGGTTCGTGTGCCAACGGCGGCGGCTATTATCA
CTATTCTTATTCCGTTGTGCGCGGTGCCGACCGTGTCGTGCCGGTGGACG
TTTATGTGCCGGGTTGTCCGCCGACTGCGGAAGCTCTGATTTACGGCCTG
ATTCAGCTCCAACAAAAAATCAAGCGCACTTCCACCATCGCGCGTGACGA
G


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy