Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1425 IGR1423.1 IGR1426 IGR1429 IGR1428 IGR1430 IGR1424 IGR1423 IGR1427 NG1755 NG1745.1 mafI, - NG1754 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 NG1755 NG1745.1 mafI, - NG1754 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 Type: tandem, Name:  - 81 Type: inverse, Name:  - 177 NG1745.1 mafI, - NG1754 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 nuoA, - NG1751 nuoC,nuoD, - NG1749 NG1753 nuoA, - NG1751 nuoC,nuoD, - NG1749 NG1753 NG1755
* Calculated from Protein Sequence

Gene ID: NG1749

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoC  nuoD  

Definition:
NADH dehydrogenase I chain C / NADH-ubiquinone oxidoreductase

Gene Start:
1711471

Gene Stop:
1710881

Gene Length:
591

Molecular Weight*:
22825

pI*:
4.70

Net Charge*:
-11.64

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Xu,X., Matsuno-Yagi,A. and Yagi,T.
Gene cluster of the energy-transducing NADH-quinone oxidoreductas
of Paracoccus denitrificans: Characterization of four structural
gene products.
Biochemistry 31, 6925-6932 (1992)
Medline: 92345253

Videira,A.,Tropschug,M.and Werner,S.
Primary structure and expression of a nuclear-coded subunit of
complex I homologous to proteins specified by the chloroplast
genome.
Biochem.Biophys.Res.Commun.171 (3),1168-1174 (1990)
Medline: 91024977

Weidner,U., Geier,S., Ptock,A., Friedrich,T., Leif,H. and Weiss,H.
The gene locus of the proton-translocating NADH: ubiquinone
oxidoreductase in Escherichia coli. Organization of the 14 genes
and relationship between the derived proteins and subunits of
mitochondrial complex I.
J. Mol. Biol.233 (1),109-122 (1993)
Medline: 93389724

Pruss,B.M., Nelms,J.M., Park,C. and Wolfe,A.J.
Mutations in NADH:ubiquinone oxidoreductase of Escherichia coli affect growth on mixed amino acids
J. Bacteriol. 176 (8), 2143-2150 (1994)
Medline: 94209210

Leif,H., Sled,V.D., Ohnishi,T., Weiss,H. and Friedrich,T.
Isolation and characterization of the proton-translocating NADH:
ubiquinone oxidoreductase from Escherichia coli
Eur. J. Biochem. 230 (2), 538-548 (1995)
Medline: 95331291



Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1741 (nuoK),NG1742(nuoJ),NG1743 (nuoI),NG1744 (nuoH),NG1745 (nuoG),
NG1746 (nuoF),NG1747 (nuoE),NG1748 (nuoD nuoC),NG1737 (nuoN), NG1750(nuoB),NG1751 (nuoA).

Oklahoma ID: NGO.1749c

Blast Summary:  PSI-Blast Search
Residues 1-197 are 90% similar to NADH dehydrogenase I chain C from Neisseria meningitidis group A strain Z2491 (emb|CAB83337.1|).

Numerous hits in gapped BLAST to NADH dehydrogenase I chain C / NADH-ubiquinone oxidoreductase sequences,e.g.residues 75-192 are 59% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa strain 9a5c (gb|AAF83118.1|).Residues 23-179 are 45% similar to NADH-Ubiquinone reductase from Homo sapiens (gb|AAD40386.1|).Residues 77-160 are 40% similar to NADH dehydrogenase I chain C from Escherichia coli (emb|CAA48362.1|). Residues 77-156 are 40% similar to NADH dehydrogenase I chain C,D from Pseudomonas aeruginosa strain PAO1 (gb|AAG06027.1|).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0852
COG name: NADH-ubiquinone oxidoreductase 27 kD subunit, NuoC/NQO5/Nad9
Functional Class:  C
The phylogenetic pattern of COG0852 is a--K-QvcE-R-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001268 (Respiratory-chain NADH dehydrogenase 30 Kd subunit) with a combined E-value of 4.9e-39.
    IPB001268    106-156


ProDom Summary:  Protein Domain Search
Residues 101-163 are 65% similar to a (OXIDOREDUCTASE SUBUNIT UBIQUINONE DEHYDROGENASE NAD NADH) protein domain (PD001581) which is seen in NUGM_BOVIN.



Paralogs:  Local Blast Search


NG1749 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 94 to 163 (E-value = 3.2e-43) place NG1749 in the Complex1_30kDa family which is described as Respiratory-chain NADH dehydrogenase, 30 Kd subunit (PF00329)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MASIQNLYETVVGVLGDQAGKVISALGEITVECLPEHYISVMTALHDHED
LHFELLVDLCGVDYSTYKNEAWQGKRFAVVSQLLSVKNNQRIRVRVWVSD
DDFPVVESVADIYNSADWYEREAFDLYGIMFNNHPDLRRILTDYGFVGHP
FRKDFPISGYVEMRYDEEQKRVIYQPVTIEPREITPRIVREENYGGQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAGCATTCAAAACTTATACGAGACCGTCGTCGGCGTGCTTGGCGA
TCAGGCAGGCAAAGTCATTTCAGCTTTGGGCGAGATTACCGTCGAGTGTC
TGCCCGAGCACTATATTTCAGTCATGACCGCATTGCACGACCATGAAGAT
TTGCATTTCGAGCTTCTGGTTGACTTGTGCGGCGTCGATTACAGCACTTA
CAAAAACGAAGCATGGCAGGGCAAACGCTTTGCCGTTGTCAGTCAGTTGC
TTTCCGTTAAAAACAATCAACGCATCCGCGTACGCGTCTGGGTTTCAGAC
GACGACTTCCCTGTAGTCGAATCCGTAGCCGATATTTACAACAGCGCGGA
TTGGTACGAGCGCGAAGCCTTCGATTTGTACGGCATCATGTTCAACAACC
ATCCCGACTTGCGCCGCATCCTGACCGATTACGGCTTTGTCGGACATCCG
TTCCGCAAAGACTTCCCGATTTCCGGCTATGTGGAAATGCGTTATGACGA
AGAGCAAAAACGCGTGATTTACCAACCTGTTACCATTGAGCCGCGCGAAA
TCACACCGCGTATCGTCCGTGAGGAGAACTACGGTGGCCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy