Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1425 IGR1423.1 IGR1426 IGR1428 IGR1424 IGR1423 IGR1427 NG1745.1 mafI, - NG1754 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 NG1745.1 mafI, - NG1754 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 Type: tandem, Name:  - 81 Type: inverse, Name:  - 177 NG1745.1 nuoE, - NG1747 nuoB, - NG1750 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 nuoA, - NG1751 nuoC,nuoD, - NG1749 NG1753 nuoC,nuoD, - NG1749 NG1753 mafI, - NG1754 nuoA, - NG1751
* Calculated from Protein Sequence

Gene ID: NG1748

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoC  nuoD  

Definition:
NADH dehydrogenase I chain C-D / NADH-ubiquinone oxidoreductase

Gene Start:
1710936

Gene Stop:
1709635

Gene Length:
1302

Molecular Weight*:
49375

pI*:
8.10

Net Charge*:
5.41

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Preis,D., van der Pas,J.C., Nehls,U., Rohlen,D.A., Sackmann,U.,
Jahnke,U. and Weiss,H.
The 49 K subunit of NADH: ubiquinone reductase (complex I) from
Neurospora crassa mitochondria: primary structure of the gene and
the protein.
Curr. Genet. 18 (1), 59-64 (1990)
Medline: 91059421

Xu,X., Matsuno-Yagi,A. and Yagi,T.
Gene cluster of the energy-transducing NADH-quinone oxidoreductas
of Paracoccus denitrificans: Characterization of four structural
gene products.
Biochemistry 31, 6925-6932 (1992)
Medline: 92345253

Leif,H., Sled,V.D., Ohnishi,T., Weiss,H. and Friedrich,T.
Isolation and characterization of the proton-translocating NADH:
ubiquinone oxidoreductase from Escherichia coli
Eur. J. Biochem. 230 (2), 538-548 (1995)
Medline: 95331291

Weidner,U., Geier,S., Ptock,A., Friedrich,T., Leif,H. and Weiss,H.
The gene locus of the proton-translocating NADH: ubiquinone
oxidoreductase in Escherichia coli. Organization of the 14 genes
and relationship between the derived proteins and subunits of
mitochondrial complex I
J. Mol. Biol. 233 (1), 109-122 (1993)
Medline: 93389724





Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1741 (nuoK),NG1742(nuoJ),NG1743 (nuoI),NG1744 (nuoH),NG1745 (nuoG),
NG1746 (nuoF),NG1747 (nuoE),NG1737 (nuoN),NG1749 (nuoD nuoC),NG1750 (nuoB),NG1751 (nuoA).

Oklahoma ID: NGO.1748c

Blast Summary:  PSI-Blast Search
Residues 17-434 are 98% similar to NADH dehydrogenase I chain D from Neisseria meningitidis group A strain Z2491 (emb|CAB83336.1|).

Numerous hits in gapped BLAST to NADH dehydrogenase I chain D / NADH-ubiquinone oxidoreductase sequences,e.g.residues 10-434 are 69% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa strain 9a5c (gb|AAF83119.1|).Residues 21-434 are 63% similar to NADH dehydrogenase (ubiquinone) Fe-S protein 2
(NADH-coenzyme Q reductase) from Homo sapiens (gb|AAH00170.1|). Residues 26-434 are 40% similar to NADH dehydrogenase I chain C,D from Pseudomonas aeruginosa strain PAO1 (gb|AAG06027.1|).Residues 26-434 are 39% similar to NADH dehydrogenase I chain C/D from Escherichia coli O157:H7 (gb|AAG57415.1|).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0649
COG name: Formate hydrogenlyase subunit 5 and NADH-ubiquinone oxidoreductase 49 kD subunit 7 (chain D), NuoD/NQO4/Nad7
Functional Class:  C
The phylogenetic pattern of COG0649 is aMTK-QvcE-R-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001135 (NADH-ubiquinone oxidoreductase 49Kd chain) with a combined E-value of 2.1e-187.
    IPB001135A    27-48
    IPB001135B    50-102
    IPB001135C    107-157
    IPB001135D    243-295
    IPB001135E    357-404
    IPB001135F    416-434


ProDom Summary:  Protein Domain Search
Residues 374-434 are 81% similar to a (UBIQUINONE OXIDOREDUCTASE DEHYDROGENASE) protein domain (PD003069) which is seen in NUCM_BOVIN.

Residues 61-316 are 30% similar to a (NADH-UBIQUINONE OXIDOREDUCTASE 49 KD) protein domain (PD128710) which is seen in NUCM_TRYBB.

Residues 20-60 are 82% similar to a (OXIDOREDUCTASE DEHYDROGENASE UBIQUINONE SUBUNIT NADH) protein domain (PD002396) which is seen in NUCM_NEUCR.

Residues 61-355 are 58% similar to a (SUBUNIT HYDROGENASE OXIDOREDUCTASE LARGE NICKEL) protein domain (PD000353) which is seen in NUCM_BOVIN.



Paralogs:  Local Blast Search


NG1748 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 137 to 434 (E-value = 5.1e-160) place NG1748 in the Complex1_49kDa family which is described as Respiratory-chain NADH dehydrogenase, 49 Kd subunit (PF00346)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
LSRAKSHRVSSVRRTTVANKLRNYTINFGPQHPAAHGVLRMILELDGEQI
VRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQAYCLAVE
KLAGIDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGAMTAILYAFRD
REELMDLYEAVSGARMHAAYFRPGGVYRDLPGFMPKYESSKFRNAKVLKQ
LNESREGTMLDFIDAFCERFPKNIDTLETLLTDNRIWKQRTVGIGVVSPE
RAMQKGFTGVMLRGSGVEWDVRKTQPYEVYDKMDFDIPVGVNGDCYDRYL
CRMEEMRQSVRIIKQCADWLRVNPGPVITANHKFAPPKRTEMKTGMEDLI
HHFKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDGANKPYRLKIRAPGF
AHLQGMDEMAKGHMLADVVAIIGTQDIVFGEVDR

Gene Nucleotide Sequence:  Sequence Viewer
TTGAGCCGCGCGAAATCACACCGCGTATCGTCCGTGAGGAGAACTACGGT
GGCCAATAAATTAAGAAACTACACCATCAACTTCGGCCCGCAGCACCCTG
CGGCGCATGGCGTATTGCGTATGATTTTGGAGCTGGACGGCGAACAAATC
GTCCGTGCCGATCCGCATATCGGCCTCCTGCACCGGGGCACCGAAAAACT
GGCGGAAACCAAAACCTATCTGCAAGCCCTGCCCTATATGGACCGTTTGG
ACTACGTTTCCATGATGGTCAACGAGCAGGCGTATTGCTTGGCGGTAGAA
AAACTTGCCGGTATCGATGTGCCTATCCGCGCCCAATACATCCGCGTGAT
GTTCGCCGAAGTAACGCGCATCCTCAATCACTTGATGGGCATCGGTTCGC
ACGCCTTCGACATCGGCGCGATGACCGCCATCCTCTACGCCTTCCGCGAC
CGCGAAGAGCTGATGGACTTGTACGAAGCCGTGTCCGGCGCACGTATGCA
CGCCGCCTACTTCCGTCCCGGCGGCGTTTACCGCGACCTACCCGGCTTTA
TGCCCAAATACGAGAGCAGCAAATTTCGCAATGCCAAAGTATTGAAGCAG
CTCAACGAATCCCGCGAAGGCACGATGCTTGACTTTATCGATGCCTTCTG
CGAACGCTTCCCCAAAAATATCGACACACTCGAAACCCTCCTGACCGACA
ACCGCATCTGGAAACAGCGTACCGTCGGCATCGGCGTTGTCTCTCCCGAG
CGCGCCATGCAAAAAGGCTTTACCGGTGTGATGCTTCGCGGTTCCGGCGT
GGAATGGGACGTGCGTAAGACACAGCCCTACGAAGTGTACGACAAAATGG
ATTTCGACATCCCCGTCGGCGTCAACGGCGACTGCTACGACCGTTACCTC
TGCCGTATGGAAGAAATGCGCCAATCCGTACGCATCATCAAACAATGCGC
CGACTGGTTGCGCGTCAATCCCGGCCCGGTCATTACCGCAAACCACAAAT
TCGCTCCGCCCAAACGTACCGAAATGAAAACAGGTATGGAAGACCTGATT
CACCATTTCAAACTCTTTACCGAGGGTATGCACGTTCCCGAGGGCGAGAC
CTACACCGCTGTCGAACACCCGAAAGGCGAGTTCGGCGTTTACATCATTT
CAGACGGCGCAAACAAACCCTACCGCCTGAAAATCCGCGCACCCGGCTTC
GCCCACCTGCAAGGCATGGACGAAATGGCAAAAGGCCATATGCTCGCCGA
CGTCGTTGCCATCATCGGTACGCAGGACATCGTATTCGGGGAGGTTGACC
GA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy