Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1425 IGR1423.1 IGR1426 IGR1424 IGR1423 IGR1427 NG1745.1 nuoE, - NG1747 nuoB, - NG1750 nuoH, - NG1744 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 NG1745.1 nuoE, - NG1747 nuoB, - NG1750 nuoH, - NG1744 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 Type: tandem, Name:  - 81 NG1745.1 nuoE, - NG1747 nuoB, - NG1750 nuoH, - NG1744 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 nuoA, - NG1751 nuoC,nuoD, - NG1749 NG1753 nuoA, - NG1751 nuoC,nuoD, - NG1749 NG1753
* Calculated from Protein Sequence

Gene ID: NG1747

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoE  

Definition:
NADH dehydrogenase I chain E / NADH-ubiquinone oxidoreductase

Gene Start:
1709632

Gene Stop:
1709162

Gene Length:
471

Molecular Weight*:
17130

pI*:
4.80

Net Charge*:
-5.00

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Weidner,U., Geier,S., Ptock,A., Friedrich,T., Leif,H. and Weiss,H.
The gene locus of the proton-translocating NADH: ubiquinone
oxidoreductase in Escherichia coli. Organization of the 14 genes
and relationship between the derived proteins and subunits of
mitochondrial complex I
J. Mol. Biol. 233 (1), 109-122 (1993)
Medline: 93389724

Chomyn,A. and Lai,S.S.
cDNA of the 24 kDa subunit of the bovine respiratory chain NADH dehydrogenase: high sequence conservation in mammals and
tissue-specific and growth-dependent expression.
Curr. Genet. 16 (2), 117-126 (1989)
Medline: 90090682



Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1741 (nuoK),NG1742 (nuoJ),NG1743 (nuoI),NG1744 (nuoH),NG1745 (nuoG),
NG1746 (nuoF),NG1737 (nuoN),NG1748 (nuoD nuoC),NG1749 (nuoD nuoC),NG1750(nuoB),NG1751 (nuoA).

Oklahoma ID: NGO.1747c

Blast Summary:  PSI-Blast Search
Residues 1-145 are 99% similar to NADH dehydrogenase I,E chain from Neisseria meningitidis group B strain MD58 (gb|AAF40699.1|).

Numerous hits in gapped BLAST to NADH dehydrogenase I chain E / NADH-ubiquinone oxidoreductase sequences,e.g.residues 1-138 are 44% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa strain 9a5c (gb|AAF83120.1|).Residues 2-136 are 34% similar to NADH dehydrogenase I chain E from Escherichia coli O157:H7 (gb|AAG57414.1|).Residues 1-137 are 32% similar to NADH dehydrogenase I chain E from Pseudomonas aeruginosa strain PAO1 (gb|AAG06028.1|).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1905
COG name: NADH-ubiquinone oxidoreductase 24 kD subunit, NuoE/NQO2
Functional Class:  C
The phylogenetic pattern of COG1905 is --t--qVce-r---------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002023 (Respiratory-chain NADH dehydrogenase 24 Kd subunit) with a combined E-value of 3.4e-51.
    IPB002023A    34-79
    IPB002023B    103-140


ProDom Summary:  Protein Domain Search
Residues 15-145 are 46% similar to a (SUBUNIT OXIDOREDUCTASE IRON-SULFUR NAD) protein domain (PD003859) which is seen in NQO2_THETH.



Paralogs:  Local Blast Search


NG1747 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 157 (E-value = 4.4e-55) place NG1747 in the Complex1_24kDa family which is described as Respiratory-chain NADH dehydrogenase 24 Kd subunit (PF01257)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MLSAKSLKQIDIELAKYPADQRRSAIMGALRIAQTEKGWLAPETIAFVAD
YIGITPAQAYEVATFYNMYDLEPVGKYKLTVCTNLPCALRGGMATGEYLK
QKLGIGYGETTPDGKFTLVEGECMGACGDAPVMLVNNHSMCSFMTEEAIE
KKLAELE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTATCCGCAAAATCCTTAAAACAAATCGACATTGAGTTGGCGAAATA
TCCCGCCGACCAACGCCGTTCCGCCATCATGGGCGCGTTGCGTATCGCCC
AAACCGAAAAAGGCTGGCTCGCCCCCGAAACCATCGCTTTTGTTGCCGAC
TACATCGGCATCACGCCGGCGCAGGCATATGAAGTCGCCACTTTCTACAA
TATGTACGACCTTGAGCCTGTCGGCAAATACAAACTGACCGTTTGTACCA
ACCTGCCCTGCGCTCTGCGCGGCGGTATGGCGACCGGCGAATACCTCAAA
CAAAAACTCGGTATCGGCTACGGCGAAACCACGCCCGACGGCAAATTTAC
CCTTGTCGAAGGCGAATGCATGGGCGCGTGCGGCGATGCCCCCGTTATGC
TGGTCAACAACCACAGCATGTGCAGCTTTATGACCGAAGAGGCGATTGAG
AAGAAACTGGCGGAGTTGGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy