Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1425 IGR1423.1 IGR1426 IGR1422 IGR1424 IGR1423 IGR1427 NG1745.1 nuoE, - NG1747 nuoI, - NG1743 nuoB, - NG1750 nuoH, - NG1744 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 NG1745.1 nuoE, - NG1747 nuoI, - NG1743 nuoB, - NG1750 nuoH, - NG1744 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 Type: tandem, Name:  - 81 NG1745.1 nuoE, - NG1747 nuoI, - NG1743 nuoB, - NG1750 nuoH, - NG1744 nuoF, - NG1746 nuoC,nuoD, - NG1748 NG1752 nuoG, - NG1745 nuoA, - NG1751 nuoC,nuoD, - NG1749 nuoC,nuoD, - NG1749 nuoA, - NG1751
* Calculated from Protein Sequence

Gene ID: NG1746

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoF  

Definition:
NADH dehydrogenase I chain F / NADH-ubiquinone oxidoreductase

Gene Start:
1708769

Gene Stop:
1707471

Gene Length:
1299

Molecular Weight*:
47406

pI*:
5.90

Net Charge*:
-6.23

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Xu,X., Matsuno-Yagi,A. and Yagi,T.
The NADH-binding subunit of the energy-transducing NADH-ubiquinone
oxidoreductase of Paracoccus denitrificans:Gene cloning and deduced primary structure.
Biochemistry 30, 6422-6428 (1991)
Medline: 91274292

Weidner,U., Geier,S., Ptock,A., Friedrich,T., Leif,H. and Weiss,H.
The gene locus of the proton-translocating NADH: ubiquinone
oxidoreductase in Escherichia coli. Organization of the 14 genes
and relationship between the derived proteins and subunits of
mitochondrial complex I
J. Mol. Biol. 233 (1), 109-122 (1993)
Medline: 93389724



Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1741 (nuoK),NG1742(nuoJ),NG1743 (nuoI),NG1744 (nuoH),NG1745 (nuoG),
NG1737 (nuoN),NG1747 (nuoE),NG1748 (nuoD nuoC),NG1749 (nuoD nuoC),NG1750 (nuoB),NG1751 (nuoA).


Oklahoma ID: NGO.1746c

Blast Summary:  PSI-Blast Search
Residues 1-433 are 99% similar to NADH dehydrogenase I, F chain from Neisseria meningitidis group B strain MD58 (gb|AAF40700.1|).

Numerous hits in gapped BLAST to NADH dehydrogenase I chain F / NADH-ubiquinone oxidoreductase sequences,e.g.residues 21-429 are 57% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa strain 9a5c (gb|AAF83121.1|).Residues 23-415 are 45% similar to NADH dehydrogenase I chain F from Escherichia coli O157:H7 (gb|AAG57413.1|).Residues 23-415 are 44% similar to NADH dehydrogenase I chain F from Pseudomonas aeruginosa strain PAO1 (gb|AAG06029.1|).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1894
COG name: NADH-ubiquinone oxidoreductase, NADH-binding (51 kD) subunit, NuoF/NQO1
Functional Class:  C
The phylogenetic pattern of COG1894 is --t--qVce-r---------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001949 (Respiratory-chain NADH dehydrogenase 51 Kd subunit) with a combined E-value of 1.8e-136.
    IPB001949A    45-74
    IPB001949B    83-120
    IPB001949C    173-225
    IPB001949D    341-381
    IPB001949E    390-414


ProDom Summary:  Protein Domain Search
Residues 26-264 are 57% similar to a (SUBUNIT IRON-SULFUR OXIDOREDUCTASE) protein domain (PD002676) which is seen in NQO1_THETH.

Residues 272-423 are 50% similar to a (SUBUNIT OXIDOREDUCTASE DEHYDROGENASE IRON-SULFUR NAD) protein domain (PD002895) which is seen in Q9ZE33_RICPR.



Paralogs:  Local Blast Search


NG1746 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 30 to 291 (E-value = 2.1e-142) place NG1746 in the Complex1_51K family which is described as Respiratory-chain NADH dehydrogenase 51 Kd subunit (PF01512)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
108  
189

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MAIYQSGVIFDQVDTANPDCWTLDEYVKRGGYTALRKILSENISQTDVID
EVKTSGLRGRGGAGFPTGLKWSFMPRSFPGEKYVVCNTDEGEPGTFKDRD
IIMFNPHALIEGMIIAGYAMGAKAGYNYIHGEIFEGYQRFEAALEQARAA
GFLGKNILGSDFEFELFAHHGYGAYICGEETALLESLEGKKGQPRFKPPF
PASFGLYGKPTTINNTETFSSVPFIIRDGGQAFADKGIPNAGGTKLFCIS
GHVERPGNYEVPLGTPFAEVLKMAGGMRGGKKLKAVIPGGSSAPVLPADI
MMQTNMDYDSISKAGSMLGSGAIIVMDEDVCMVKALERLSYFYYDESCGQ
CTPCREGTGWLYRIVRRIVEGKGRMEDLDLLDSVGNQMAGRTICALADAA
VFPVRSFTKHFRDEFAHYIEHGGPMKEHKWGGW

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTATTTACCAATCAGGCGTGATTTTTGACCAAGTGGATACCGCCAA
TCCCGATTGCTGGACATTGGACGAATACGTCAAACGCGGCGGCTATACCG
CCCTGCGTAAAATCCTGTCCGAAAACATCTCGCAAACCGATGTGATTGAC
GAAGTCAAAACCTCCGGCTTGCGCGGGCGCGGCGGTGCGGGCTTCCCGAC
CGGTTTGAAATGGAGCTTTATGCCCCGTTCTTTCCCGGGCGAAAAATATG
TGGTTTGCAACACCGACGAAGGCGAGCCGGGTACATTTAAAGACCGCGAC
ATCATCATGTTCAATCCTCATGCCCTGATTGAAGGCATGATCATTGCCGG
TTACGCGATGGGCGCGAAAGCCGGCTACAACTATATCCACGGCGAAATTT
TCGAAGGTTATCAACGCTTTGAAGCCGCTTTGGAGCAGGCGCGTGCCGCA
GGCTTTTTGGGTAAAAATATTTTGGGTTCGGATTTTGAATTCGAACTCTT
CGCCCACCACGGCTACGGCGCATATATTTGCGGCGAAGAAACCGCATTGC
TTGAATCGTTGGAAGGCAAAAAAGGCCAGCCGCGCTTCAAACCGCCGTTC
CCCGCCTCGTTCGGCCTGTACGGCAAACCGACCACCATCAACAATACCGA
AACGTTCTCCTCCGTCCCGTTTATTATCCGTGACGGCGGACAGGCGTTTG
CCGATAAAGGTATTCCGAATGCAGGCGGTACCAAATTATTTTGTATTTCC
GGCCATGTCGAGCGTCCGGGCAACTATGAAGTGCCGTTGGGCACGCCGTT
TGCCGAAGTCTTGAAAATGGCGGGCGGTATGCGCGGCGGTAAAAAACTCA
AAGCCGTTATTCCCGGCGGTTCGTCCGCCCCCGTATTGCCTGCCGACATT
ATGATGCAGACCAATATGGACTATGACTCGATTTCCAAAGCCGGCTCGAT
GCTCGGTTCCGGCGCGATTATCGTGATGGACGAAGACGTGTGCATGGTCA
AAGCCCTCGAACGCTTAAGCTATTTCTACTACGACGAATCCTGCGGCCAA
TGCACCCCCTGCCGCGAAGGTACCGGCTGGCTTTACCGCATCGTCCGCCG
CATCGTAGAAGGCAAAGGCCGCATGGAAGACTTGGATTTGCTGGATTCTG
TCGGCAACCAAATGGCAGGCCGCACCATCTGCGCCCTTGCCGATGCCGCC
GTCTTCCCTGTCCGCAGCTTTACCAAGCATTTCCGTGATGAGTTTGCGCA
TTACATCGAACACGGCGGGCCGATGAAAGAGCATAAGTGGGGAGGGTGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy