Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1425 IGR1423.1 IGR1420 IGR1421 IGR1422 IGR1424 IGR1423 NG1745.1 nuoK, - NG1741 nuoE, - NG1747 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoF, - NG1746 nuoC,nuoD, - NG1748 nuoL, - NG1740 nuoG, - NG1745 NG1745.1 nuoK, - NG1741 nuoE, - NG1747 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoF, - NG1746 nuoC,nuoD, - NG1748 nuoL, - NG1740 nuoG, - NG1745 NG1745.1 nuoK, - NG1741 nuoE, - NG1747 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoF, - NG1746 nuoC,nuoD, - NG1748 nuoL, - NG1740 nuoG, - NG1745
* Calculated from Protein Sequence

Gene ID: NG1745

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoG  

Definition:
NADH Dehydrogenase I chain G / NADH-ubiquinone oxidoreductase

Gene Start:
1706755

Gene Stop:
1704497

Gene Length:
2259

Molecular Weight*:
81386

pI*:
6.10

Net Charge*:
-11.01

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Harkness,T.A., Rothery,R.A., Weiner,J.H., Werner,S., Azevedo,J.E., Videira,A. and Nargang,F.E.
Disruption of the gene encoding the 78-kilodalton subunit of the peripheral arm of complex I in Neurospora crassa by repeat induced
point mutation (RIP)
Curr. Genet. 27 (4),339-350 (1995)
Medline: 95339408
Weidner,U.,Geier,S., Ptock,A.,Friedrich,T., Leif,H. and Weiss,H.
The gene locus of the proton-translocating NADH: ubiquinone
oxidoreductase in Escherichia coli.Organization of the 14 genes
and relationship between the derived proteins and subunits of
mitochondrial complex I
J. Mol. Biol. 233 (1),109-122 (1993)
Medline: 93389724

Archer,C.D., Wang,X. and Elliott,T.
Mutants defective in the energy-conserving NADH dehydrogenase of
Salmonella typhimurium identified by a decrease in energy-dependent proteolysis after carbon starvation.
Proc. Natl. Acad. Sci. U.S.A. 90 (21), 9877-9881 (1993)
Medline: 94052195




Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1741 (nuoK),NG1742(nuoJ),NG1743 (nuoI),NG1744 (nuoH),NG1737 (nuoN),
NG1746 (nuoF),NG1747 (nuoE),NG1748 (nuoD nuoC),NG1749 (nuoD nuoC),NG1750 (nuoB),NG1751 (nuoA).

Oklahoma ID: NGO.1745c

Blast Summary:  PSI-Blast Search
Residues 1-753 are 95% similar to NADH dehydrogenase I chain G from Neisseria meningitidis group A strain Z2491 (emb|CAB83330.1|).

Numerous hits in gapped BLAST to NADH dehydrogenase I chain G / NADH-ubiquinone oxidoreductase sequences,e.g.residues 4-704 are 41% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa strain 9a5c (gb|AAF83122.1|).Residues 1-590 are 26% similar to NADH dehydrogenase I chain G from Escherichia coli (1799649|).Residues 1-607 are 25% similar to NADH dehydrogenase I chain G from Pseudomonas aeruginosa strain PAO1 (gb|AAG06030.1|).Residues 1-610 are 37% similar to NADH dehydrogenase (ubiquinone) Fe-S protein 1 from Homo sapiens (13637608|).

COGS Summary:  COGS Search
BeTs to 9 clades of COG1034
COG name: NADH dehydrogenase 75 kD subunit (chain G), NuoG/NQO3/Nad11
Functional Class:  C
The phylogenetic pattern of COG1034 is --t--qVceBr-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000283 (Respiratory-chain NADH dehydrogenase 75 Kd subunit) with a combined E-value of 3.9e-112.
    IPB000283A    4-49
    IPB000283B    83-111
    IPB000283C    136-162
    IPB000283D    187-214
    IPB000283E    249-260
    IPB000283F    570-583
***** IPB001467 (Prokaryotic molybdopterin oxidoreductases) with a combined E-value of 1.2e-06.
    IPB001467A    258-280
    IPB001467B    282-304
    IPB001467C    547-572


ProDom Summary:  Protein Domain Search
Residues 273-610 are 23% similar to a (OXIDOREDUCTASE SUBUNIT IRON-SULFUR REDUCTASE MOLYBDENUM) protein domain (PD000381) which is seen in NUAM_SOLTU.

Residues 61-133 are 61% similar to a (IRON-SULFUR SUBUNIT OXIDOREDUCTASE DEHYDROGENASE 4FE-4S) protein domain (PD002417) which is seen in Q9ZCF6_RICPR.

Residues 206-268 are 50% similar to a (OXIDOREDUCTASE UBIQUINONE SUBUNIT NAD) protein domain (PD007720) which is seen in Q9ZCF6_RICPR.

Residues 144-205 are 64% similar to a (IRON-SULFUR OXIDOREDUCTASE SUBUNIT DEHYDROGENASE 4FE-4S) protein domain (PD002972) which is seen in NUAM_RECAM.

Residues 2-52 are 58% similar to a (SUBUNIT UBIQUINONE OXIDOREDUCTASE MITOCHONDRION) protein domain (PD004818) which is seen in Q01388_NEUCR.

Residues 2-52 are 52% similar to a (IRON-SULFUR FERREDOXIN ELECTRON TRANSPORT CHLOROPLAST) protein domain (PD000232) which is seen in NUAM_BOVIN.



Paralogs:  Local Blast Search


NG1745 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 68 (E-value = 1.5e-11) place NG1745 in the Fer2 family which is described as 2Fe-2S iron-sulfur cluster binding domain (PF00111)
Residues 273 to 610 (E-value = 3.8e-101) place NG1745 in the Molybdopterin family which is described as Molybdopterin oxidoreductase (PF00384)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
432  
460
non-globular  
465  
577

PDB Hit:
pdb|1C4A|1C4A-A BINDING OF EXOGENOUSLY ADDED CARBON MONOXIDE AT 65.6 3e-11

Gene Protein Sequence:
MLQIEIDGKQVSVEQGATVIEAAHKLGTYIPHFCYHKKLSIAANCRMCLV
DVEKAPKPLPACATPVTDGMIVRTHSAKAREAQEGVMEFLLINHPLDCPT
CDQGGECQLQDLAVGYGKTTSRYTEEKRSVVGKDMGPLVSAEEMSRCIHC
TRCVRFTEEIAGLQEIAMVNRGEHSEIMPFIGKAVETELSGNVIDLCPVG
ALTSKPFRFNARTWELNRRKSVSAHDALGSNLIVQTKDHTVRRVLPLENE
AINECWLSDRDRFAYEGLYHESRLKNPKIKQGGEWMDVDWKTALEYVRSA
IECIAKDGNQNQVGVWANPMNTVEELYLAKKFADGLGVKNFATRLRQQDK
RLSDGLKGAQWLGQSIESLADNDAVLVVGANLRKEQPLLTARLRRAAKDR
MALSVLAGSKEELFMPLLSQEAAHPDEWAGRLKNLSADAEHAVTASLKNA
EKAAVILGAEVQNHPDYAAIYAAAQELADATGAVLGILPQAANSVGADVL
GVNSGESVAEMANTPKQAVLLLNVEPEIDTVDGAKAVAALKQAKSVMAFT
PFVSETLLDVCDVLLPIAPFTETSGSFINMEGRLQSFHGVVQGFGDSRPM
WKVLRVLGNLFDLKGFEYHDTAAILKDALDAESLPSKLDNRSTWAGEGVQ
TASNRLVRVGGVGIYHTDSIVRRSAPLQETSHAAVPAARVNPNTLARLGL
QDGQTAVAKQNGASVSVAVKADAGLPENVVHLPLHTENAALGALMGIIEL
AGA

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTACAAATCGAAATCGACGGCAAACAGGTATCTGTGGAGCAGGGCGC
GACGGTAATTGAAGCCGCGCACAAGCTCGGTACTTATATTCCGCATTTCT
GTTACCACAAAAAGCTCTCTATTGCCGCCAACTGCCGTATGTGTCTGGTG
GATGTGGAAAAAGCCCCCAAACCGCTGCCTGCCTGTGCCACGCCGGTAAC
GGACGGCATGATTGTGCGTACGCATTCGGCAAAAGCCCGAGAGGCGCAGG
AAGGCGTGATGGAGTTCCTGCTCATCAACCATCCGCTTGATTGTCCGACC
TGCGACCAGGGCGGCGAATGCCAGTTGCAGGATTTGGCGGTGGGCTACGG
CAAAACCACCAGCCGTTATACCGAAGAAAAACGTTCCGTCGTCGGCAAGG
ACATGGGTCCTTTGGTTTCCGCCGAGGAAATGAGCCGCTGTATCCACTGT
ACCCGCTGCGTACGTTTCACCGAAGAAATCGCCGGTTTGCAGGAAATTGC
GATGGTGAATCGTGGTGAACACTCCGAAATCATGCCCTTTATCGGCAAAG
CGGTGGAAACCGAGCTGTCGGGCAACGTCATCGATTTGTGTCCCGTCGGC
GCATTGACCAGCAAACCGTTCCGCTTCAACGCGCGTACTTGGGAATTGAA
CCGCCGCAAATCCGTTTCCGCACACGACGCTTTGGGCAGCAACCTGATTG
TACAAACCAAAGACCATACCGTCCGCCGCGTGTTGCCGTTGGAAAACGAA
GCCATCAACGAATGCTGGCTGTCCGACCGCGACCGTTTTGCCTACGAAGG
CCTGTATCACGAAAGCCGTCTGAAAAATCCGAAAATCAAACAGGGTGGCG
AGTGGATGGACGTGGATTGGAAAACCGCGTTGGAATATGTCCGCAGCGCG
ATTGAATGTATCGCCAAAGACGGCAACCAAAACCAAGTCGGCGTTTGGGC
TAATCCGATGAATACGGTTGAAGAGCTGTATCTGGCCAAAAAATTTGCCG
ACGGCTTGGGTGTTAAAAACTTTGCAACCCGTTTGCGCCAACAAGACAAA
CGTCTTTCAGACGGCCTTAAAGGTGCGCAATGGTTGGGACAAAGTATTGA
ATCTTTGGCTGACAACGATGCCGTATTGGTAGTCGGTGCGAACTTGCGCA
AAGAACAGCCGCTCCTGACCGCCCGCCTGCGCCGCGCCGCCAAAGACCGT
ATGGCCTTGAGCGTATTGGCCGGCAGTAAAGAAGAATTGTTTATGCCGCT
TCTGTCTCAAGAAGCCGCACATCCCGACGAGTGGGCAGGCCGTCTGAAAA
ACCTGTCTGCCGATGCGGAACATGCCGTTACCGCCAGCCTGAAAAACGCT
GAAAAAGCAGCGGTGATTTTGGGTGCGGAAGTGCAAAACCATCCTGATTA
CGCCGCCATTTATGCCGCCGCGCAAGAGTTGGCGGACGCGACCGGCGCAG
TGCTGGGCATTTTGCCGCAAGCCGCCAACAGCGTCGGTGCGGACGTATTG
GGTGTGAACTCGGGCGAGAGCGTTGCCGAAATGGCAAACACGCCGAAACA
GGCAGTCTTGCTGCTCAACGTCGAGCCTGAAATCGATACGGTTGACGGTG
CAAAAGCCGTAGCCGCGTTGAAACAGGCGAAAAGCGTGATGGCGTTTACG
CCGTTTGTCAGCGAAACGCTGCTGGACGTGTGCGACGTATTGCTGCCGAT
TGCGCCGTTTACCGAAACATCAGGCAGCTTCATCAATATGGAAGGCCGTC
TGCAATCTTTCCACGGCGTGGTACAAGGCTTCGGCGATTCACGTCCGATG
TGGAAAGTGTTGCGCGTATTGGGCAACCTGTTTGACCTGAAAGGTTTTGA
ATACCACGATACCGCTGCGATTCTGAAAGACGCGCTGGATGCGGAAAGTC
TGCCGTCCAAACTGGACAACCGCAGCACATGGGCAGGGGAGGGCGTTCAG
ACGGCCTCAAACCGCCTCGTCCGTGTCGGCGGCGTCGGTATTTATCATAC
TGATTCTATCGTGCGCCGTTCCGCACCGTTGCAAGAAACCAGCCATGCCG
CCGTGCCTGCCGCGCGTGTGAATCCGAACACATTGGCACGCTTGGGCCTG
CAAGACGGACAAACCGCTGTCGCCAAACAAAACGGTGCAAGCGTATCGGT
TGCCGTCAAAGCCGATGCCGGTTTGCCTGAAAACGTGGTGCATCTGCCGC
TGCATACCGAAAATGCCGCGCTGGGTGCGTTGATGGGCATTATTGAACTG
GCGGGAGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy