Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1423.1 IGR1420 IGR1421 IGR1422 IGR1419 IGR1424 IGR1423 NG1745.1 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 NG1739 nuoF, - NG1746 nuoL, - NG1740 nuoG, - NG1745 NG1745.1 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 NG1739 nuoF, - NG1746 nuoL, - NG1740 nuoG, - NG1745 NG1745.1 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 NG1739 nuoF, - NG1746 nuoL, - NG1740 nuoG, - NG1745
* Calculated from Protein Sequence

Gene ID: NG1744

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoH  

Definition:
NADH dehydrogenase I, H chain / NADH-ubiquinone oxidoreductase

Gene Start:
1704497

Gene Stop:
1703418

Gene Length:
1080

Molecular Weight*:
40050

pI*:
9.80

Net Charge*:
4.43

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Weidner,U., Geier,S., Ptock,A., Friedrich,T., Leif,H. and Weiss,H.
The gene locus of the proton-translocating NADH: ubiquinone
oxidoreductase in Escherichia coli. Organization of the 14 genes
and relationship between the derived proteins and subunits of
mitochondrial complex I.
J. Mol. Biol. 233 (1), 109-122 (1993)
Medline: 93389724


Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1741 (nuoK),NG1742 (nuoJ),NG1743 (nuoI),NG1737 (nuoN),NG1745 (nuoG),
NG1746 (nuoF),NG1747 (nuoE),NG1748 (nuoD nuoC),NG1749 (nuoD nuoC),NG1750 (nuoB),NG1751 (nuoA).


Oklahoma ID: NGO.1744c

Blast Summary:  PSI-Blast Search
Residues 3-360 are 91% similar to NADH dehydrogenase I,H chain from Neisseria meningitidis group B strain MD58 (gb|AAF40704.1|).

Numerous hits in gapped BLAST to NADH dehydrogenase I chain H/ NADH-ubiquinone oxidoreductase sequences,e.g.residues 46-354 are 57% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa strain 9a5c (gb|AAF83123.1|).Residues 46-347 are 41% similar to NADH dehydrogenase I chain H from Escherichia coli O157:H7 (gb|AAG57411.1|).Residues 46-354 are 37% similar to NADH dehydrogenase I chain H from Pseudomonas aeruginosa strain PAO1 (gb|AAG06031.1|).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1005
COG name: NADH-ubiquinone oxidoreductase subunit 1 (chain H), NuoH/NQO8/Nad1
Functional Class:  C
The phylogenetic pattern of COG1005 is a----Q-ce-r-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001694 (Respiratory-chain NADH dehydrogenase subunit 1) with a combined E-value of 1.3e-120.
    IPB001694A    50-103
    IPB001694B    130-184
    IPB001694C    211-265
    IPB001694D    314-342


ProDom Summary:  Protein Domain Search
Residues 95-286 are 43% similar to a (PROTEIN MITOCHONDRION TRANSMEMBRANE OXIDOREDUCTASE NAD) protein domain (PD000148) which is seen in Q9ZZ38_TRIRU.

Residues 46-87 are 76% similar to a (MITOCHONDRION OXIDOREDUCTASE NAD TRANSMEMBRANE NADH) protein domain (PD000265) which is seen in Q9ZCF7_RICPR.

Residues 315-346 are 65% similar to a (OXIDOREDUCTASE NAD TRANSMEMBRANE MITOCHONDRION CHAIN) protein domain (PD005603) which is seen in Q37629_PROWI.

Residues 143-279 are 54% similar to a (OXIDOREDUCTASE TRANSMEMBRANE NAD MITOCHONDRION) protein domain (PD000266) which is seen in NU1M_MARPO.

Residues 280-352 are 35% similar to a (F420H2:QUINONE OXIDOREDUCTASE, 41.2 KDA) protein domain (PD201724) which is seen in O28444_ARCFU.

Residues 91-141 are 49% similar to a (OXIDOREDUCTASE NAD TRANSMEMBRANE MITOCHONDRION CHAIN) protein domain (PD000304) which is seen in NU1M_ACACA.



Paralogs:  Local Blast Search


NG1744 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 29 to 353 (E-value = 2.2e-151) place NG1744 in the NADHdh family which is described as NADH dehydrogenase (PF00146)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
74
transmembrane  
26  
42
transmembrane  
101  
117
transmembrane  
132  
148
transmembrane  
174  
190
transmembrane  
213  
229
non-globular  
214  
315
transmembrane  
256  
272
transmembrane  
337  
353

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
LIMQEWFQNLFAATLGLGDLGITVGLVVSVIVKIVIILIPLILTVAYLTY
FERKVIGFMQLRVGPNVTGPRGLIQPFADVFKLLFKEVTRPKLSNKALFY
IGPIMSLAPSFAAWAVIPFNEEWVLTNINIGLLYILMITSLSVYGVIIAG
WASNSKYSFLGAMRASAQSISYEIAMSAALVCVVMVSGSMNFSDIVAAQA
KGIAGGSVFSWNWLPLFPIFIVYLISAVAETNRAPFDVAEGESEIVAGHH
VEYSGFAFALFFLAEYIFMILIAALTSLMFLGGWLSPFPQSWGIVGTPSA
FWMFVKMAAVLYWYLWIRATFPRYRYDQIMRLGWKVLIPIGFAYIVVLGV
WMISPLNLWK

Gene Nucleotide Sequence:  Sequence Viewer
TTGATTATGCAGGAATGGTTCCAAAACCTCTTTGCCGCAACGCTCGGTCT
GGGCGATTTGGGCATCACCGTAGGCTTGGTGGTATCCGTCATCGTCAAAA
TCGTGATTATCCTGATTCCGCTGATTCTGACCGTTGCCTACCTGACGTAT
TTCGAACGTAAAGTCATCGGCTTTATGCAGCTTCGCGTCGGCCCGAACGT
AACCGGCCCGCGGGGTCTGATTCAGCCGTTTGCCGACGTGTTCAAACTCT
TGTTTAAAGAGGTAACCCGTCCGAAGCTGTCAAACAAAGCCTTATTCTAC
ATCGGCCCGATTATGTCGCTCGCCCCGTCTTTCGCGGCGTGGGCGGTGAT
TCCGTTTAACGAAGAATGGGTGCTGACCAATATCAATATCGGCCTTTTGT
ACATCCTGATGATTACCTCGCTGTCGGTTTACGGCGTGATTATCGCGGGC
TGGGCTTCCAACTCCAAATATTCGTTCTTGGGTGCAATGCGTGCTTCCGC
GCAAAGCATTTCCTACGAGATTGCCATGAGTGCCGCGCTGGTGTGCGTTG
TGATGGTATCGGGCAGCATGAACTTCTCCGACATCGTTGCCGCGCAGGCA
AAAGGCATCGCGGGCGGTTCTGTGTTCTCGTGGAACTGGCTGCCGCTGTT
CCCAATCTTCATCGTCTATCTGATTTCCGCCGTTGCCGAAACCAACCGCG
CACCGTTTGACGTGGCAGAGGGCGAGTCTGAAATCGTTGCCGGACACCAC
GTCGAATACTCCGGCTTTGCATTCGCGCTGTTCTTCCTTGCCGAATACAT
TTTCATGATTCTGATTGCCGCGCTGACATCGCTGATGTTCCTCGGCGGCT
GGTTGTCTCCGTTCCCGCAAAGCTGGGGCATTGTCGGTACGCCTTCCGCA
TTCTGGATGTTCGTGAAAATGGCGGCGGTGCTGTACTGGTATCTGTGGAT
TCGTGCAACCTTCCCACGCTACCGCTACGACCAAATCATGCGTTTGGGCT
GGAAAGTGCTGATTCCGATCGGCTTCGCCTACATCGTGGTTTTGGGCGTG
TGGATGATTTCACCGCTGAATTTGTGGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy