Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1423.1 IGR1420 IGR1421 IGR1422 IGR1419 IGR1423 NG1745.1 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoF, - NG1746 nuoM, - NG1738 nuoL, - NG1740 nuoG, - NG1745 NG1745.1 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoF, - NG1746 nuoM, - NG1738 nuoL, - NG1740 nuoG, - NG1745 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoF, - NG1746 nuoL, - NG1740 nuoG, - NG1745 NG1739 NG1739 nuoM, - NG1738 NG1745.1
* Calculated from Protein Sequence

Gene ID: NG1743

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoI  

Definition:
NADH Dehydrogenase I chain I/NADH-ubiquinone oxidoreductase

Gene Start:
1703349

Gene Stop:
1702858

Gene Length:
492

Molecular Weight*:
18790

pI*:
7.60

Net Charge*:
1.83

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Djafarzadeh,R., Kerscher,S., Zwicker,K.,Radermacher,M.,Lindahl,M., Schagger,H.and Brandt,U.
Biophysical and structural characterization of proton-translocating NADH-dehydrogenase (complex I) from the strictly aerobic yeast Yarrowia lipolytica.
Biochim. Biophys. Acta 1459 (1), 230-238 (2000)
Medline: 20439569


Duarte,M., Finel,M. and Videira,A.
Primary structure of a ferredoxin-like iron-sulfur subunit of complex I from Neurospora crassa.
Biochim. Biophys. Acta 1275 (3), 151-153 (1996)
Medline: 96332621


Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1741 (nuoK),NG1742(nuoJ),NG1737 (nuoN),NG1744 (nuoH),NG1745 (nuoG),
NG1746 (nuoF),NG1747 (nuoE),NG1748 (nuoD nuoC), NG1749(nuoD nuoC),NG1750(nuoB),NG1751 (nuoA).

Oklahoma ID: NGO.1743c

Blast Summary:  PSI-Blast Search
Residues 6-164 are 100% similar to NADH dehydrogenase I, chain I from Neisseria meningitidis group A strain Z2491 (gb|AAF40705.1|).

Numerous hits in gapped BLAST to NADH-ubiquinone dehydrogenase/ NADH-ubiquinone oxidoreductase sequences,e.g.residues 11-164 are 71% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa strain 9a5c (gb|AAF83124.1|).Residues 4-146 are 39% similar to NADH dehydrogenase I, chain I from Escherichia coli (1799641|).Residues 30-146 are 44% similar to NADH dehydrogenase I, chain I from Pseudomonas aeruginosa (gb|AAG06032.1|).Residues 11-164 are 61% similar to mitochondrial NADH dehydrogenase-ubiquinone Fe-S protein from Homo sapiens (gb|AAB51776.1|).


COGS Summary:  COGS Search
BeTs to 7 clades of COG1143
COG name: Formate hydrogenlyase subunit 6/NADH-ubiquinone oxidoreductase 23 kD subunit (chain I), NuoI/NQO9/FrxB
Functional Class:  C
The phylogenetic pattern of COG1143 is -mtK-QvcE-r-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00353 (4Fe-4S ferredoxin signature) with a combined E-value of 6.1e-12.
    PR00353A    97-108
    PR00353B    109-120
    PR00353B    70-81


ProDom Summary:  Protein Domain Search
Residues 62-119 are 84% similar to a (IRON-SULFUR PROTEIN 4FE-4S TRANSPORT SUBUNIT ELECTRON) protein domain (PD000058) which is seen in NUIM_ARATH.

Residues 15-61 are 59% similar to a (IRON-SULFUR OXIDOREDUCTASE NADH-UBIQUINONE UBIQUINONE) protein domain (PD004463) which is seen in NUIM_ARATH.



Paralogs:  Local Blast Search


NG1743 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 58 to 81 (E-value = 5.9e-05) place NG1743 in the Fer4 family which is described as 4Fe-4S binding domain (PF00037)
Residues 97 to 120 (E-value = 5.8e-09) place NG1743 in the Fer4 family which is described as 4Fe-4S binding domain (PF00037)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|2FDN|2FDN 2[4FE-4S] 46.9 2e-06
pdb|1FCA|1FCA FERREDOXIN 46.1 4e-06
pdb|1HFE|1HFE-L 1.6 A RESOLUTION STRUCTURE OF THE FE-ONLY 39.1 5e-04
pdb|1KF6|1KF6-B E. COLI QUINOL-FUMARATE REDUCTASE W

Gene Protein Sequence:
LREHNMANLVKTFLLGELVKGMGVTLKNFFARKDTIYFPEEKTPQSVRFR
GLHAQRRYPNGEERCIACKLCEAVCPAMAINIESEEREDGTRRTKRYDID
LTKCIFCGFCEEACPTDAIVETHIFEYHGEKKGDLHMTKPILLAIGDKYE
AEIAKRKAADAPYR

Gene Nucleotide Sequence:  Sequence Viewer
TTGAGGGAACATAATATGGCTAACTTAGTAAAAACCTTTCTGCTTGGCGA
ACTGGTCAAAGGCATGGGCGTAACGCTCAAAAACTTTTTTGCCCGCAAAG
ACACAATTTATTTTCCCGAAGAGAAAACGCCGCAATCCGTGCGTTTCCGC
GGTCTGCACGCGCAACGCCGTTATCCGAACGGAGAGGAACGCTGCATCGC
GTGTAAATTGTGCGAGGCGGTGTGTCCGGCAATGGCGATCAACATCGAAT
CGGAAGAACGCGAAGACGGCACCCGCCGCACCAAGCGTTACGACATCGAC
CTGACCAAGTGCATCTTCTGCGGTTTCTGCGAAGAGGCCTGCCCGACCGA
TGCGATTGTGGAAACCCATATTTTTGAATACCACGGCGAGAAAAAAGGCG
ACTTGCATATGACCAAGCCCATCCTCTTGGCAATCGGCGACAAATACGAA
GCCGAAATCGCCAAACGCAAAGCCGCTGACGCGCCGTACCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy