Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1423.1 IGR1420 IGR1421 IGR1422 IGR1419 IGR1423 NG1745.1 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoF, - NG1746 nuoM, - NG1738 nuoL, - NG1740 nuoG, - NG1745 NG1745.1 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoF, - NG1746 nuoM, - NG1738 nuoL, - NG1740 nuoG, - NG1745 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoF, - NG1746 nuoM, - NG1738 nuoL, - NG1740 nuoG, - NG1745 NG1739 NG1739 NG1745.1
* Calculated from Protein Sequence

Gene ID: NG1742

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoJ  

Definition:
NADH dehydrogenase I,J chain (ubiquinone oxidoreductase)

Gene Start:
1702843

Gene Stop:
1702175

Gene Length:
669

Molecular Weight*:
24448

pI*:
7.00

Net Charge*:
0.00

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Dupuis,A., Peinnequin,A., Chevallet,M., Lunardi,J.,Darrouzet,E., Pierrard,B., Procaccio,V. and Issartel,J.P.
Identification of five Rhodobacter capsulatus genes encoding the
equivalent of ND subunits of the mitochondrial NADH-ubiquinone
oxidoreductase.
Gene 167(1/2), 99-104 (1995)

Haouazine,N., Pereira de Souza,A., Jubier,M.F., Lancelin,D.,
Delcher,E. and Lejeune,B.
The wheat mitochondrial genome contains an ORF showing sequence
homology to the gene encoding the subunit 6 of the NADH-ubiquinone
oxidoreductase.
Plant Mol. Biol.20 (3),395-404 (1992)
Medline: 93043030

Haouazine-Takvorian,N., Takvorian,A., Jubier,M.F. and Lejeune,B.
Genes encoding subunit 6 of NADH dehydrogenase and subunit 6 of ATP synthase are co-transcribed in maize mitochondria
Curr. Genet. 31 (1), 63-69 (1997)
Medline: 97153469

Weidner,U., Geier,S., Ptock,A., Friedrich,T., Leif,H. and Weiss,H.
The gene locus of the proton-translocating NADH: ubiquinone oxidoreductase in Escherichia coli. Organization of the 14 genes
and relationship between the derived proteins and subunits of
mitochondrial complex I
J. Mol. Biol. 233 (1),109-122 (1993)
Medline: 93389724



Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1741 (nuoK),NG1737(nuoN),NG1743 (nuoI),NG1744 (nuoH),NG1745 (nuoG),
NG1746 (nuoF),NG1747 (nuoE),NG1748 (nuoD nuoC),NG1749 (nuoD nuoC), NG1750(nuoB),NG1751 (nuoA).

Oklahoma ID: NGO.1742c

Blast Summary:  PSI-Blast Search
Residues 1-223 are 93% similar to NADH dehydrogenase I chain J,from Neisseria meningitidis group A strain Z2491 (emb|CAB83326.1|).

Numerous hits in gapped BLAST to NADH dehydrogenase I, J chain sequences,e.g.residues 6-201 are 42% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa strain 9a5c (gb|AAF83125.1|).Residues 8-162 are 32% similar to NADH dehydrogenase I chain J from Escherichia coli (emb|CAA48369.1|). Residues 8-79 are 43% similar to NADH dehydrogenase I chain J from Pseudomonas aeruginosa strain PAO1 (gb|AAG06033.1|).


COGS Summary:  COGS Search
BeTs to 4 clades of COG0839
COG name: NADH-ubiquinone oxidoreductase subunit 6 (chain J), NuoJ/NQO10/Nad6
Functional Class:  C
The phylogenetic pattern of COG0839 is -----Q-ce-r-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001457 (NADH-ubiquinone/plastoquinone oxidoreductase chain 6) with a combined E-value of 7.1e-19.
    IPB001457    42-83


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1742 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 167 (E-value = 1.2e-19) place NG1742 in the Oxidored_q3 family which is described as NADH-ubiquinone/plastoquinone oxidoreductase chain 6 (PF00499)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
111
cleavable N-terminal sequence  
1  
43
transmembrane  
58  
74
transmembrane  
95  
111
transmembrane  
150  
166

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTFSVILFYILAAIVLYGAVRTVTAKNPVHAALHLVLTFCVSAMIWMLMQ
AEFLGVTLVVVYVGAVMVLFLFVVMMLNIDIEEMRAGFWRHAPVAGVVGT
LLAVALILILVNPKTDLAAFGLMKDIPADYNNIRDLGSRIYTDYLLPFEL
AAVLLLLGMVAAIALVHRKTTNPKRMDPADQVKVRADQGRMRLVKMEAVK
PQVESAEESEVSDGLKTEGEGKA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTTTTTCCGTGATTCTGTTCTATATCCTTGCCGCCATCGTTTTGTA
CGGTGCGGTTCGTACCGTTACCGCCAAAAACCCTGTCCATGCCGCTTTGC
ATCTGGTGCTGACCTTCTGCGTGAGCGCGATGATTTGGATGCTGATGCAG
GCGGAGTTTTTGGGCGTGACGCTGGTGGTGGTTTACGTCGGCGCCGTAAT
GGTGTTGTTCCTGTTCGTCGTGATGATGCTGAATATCGACATCGAGGAAA
TGCGCGCCGGTTTCTGGCGGCACGCGCCTGTTGCCGGTGTGGTCGGTACG
TTGTTGGCGGTTGCCCTGATCCTGATTCTGGTCAACCCGAAAACCGACCT
GGCCGCATTTGGTCTGATGAAAGACATTCCGGCCGATTACAACAATATCC
GCGATTTGGGCAGCCGTATTTATACCGACTACCTGTTGCCGTTTGAATTG
GCGGCGGTATTGCTGCTGTTGGGCATGGTGGCCGCGATTGCATTGGTTCA
CCGCAAAACCACCAATCCGAAACGTATGGATCCAGCCGACCAAGTTAAAG
TACGCGCCGATCAAGGCCGTATGCGTCTGGTGAAAATGGAAGCGGTCAAA
CCGCAAGTCGAATCTGCCGAAGAAAGCGAAGTTTCAGACGGCCTCAAGAC
GGAAGGGGAGGGCAAAGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy