Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1420 IGR1421 IGR1422 IGR1419 IGR1423 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoM, - NG1738 nuoL, - NG1740 nuoG, - NG1745 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoM, - NG1738 nuoL, - NG1740 nuoG, - NG1745 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoM, - NG1738 nuoL, - NG1740 nuoG, - NG1745 NG1739 NG1739
* Calculated from Protein Sequence

Gene ID: NG1741

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoK  

Definition:
NADH dehydrogenase I,chain K (ubiquinone oxidoreductase)

Gene Start:
1702175

Gene Stop:
1701873

Gene Length:
303

Molecular Weight*:
11062

pI*:
6.50

Net Charge*:
-0.54

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Nelson,M.A. and Macino,G.
Structure and expression of the overlapping ND4L and ND5 genes of
Neurospora crassa mitochondria.
Mol. Gen. Genet. 206 (2), 307-317 (1987)
Medline: 87228330

Weidner,U., Geier,S., Ptock,A., Friedrich,T., Leif,H. and Weiss,H.
The gene locus of the proton-translocating NADH: ubiquinone
oxidoreductase in Escherichia coli. Organization of the 14 genes
and relationship between the derived proteins and subunits of
mitochondrial complex I
J. Mol. Biol. 233 (1), 109-122 (1993)
Medline: 93389724



Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1737 (nuoN),NG1742(nuoJ),NG1743 (nuoI),NG1744 (nuoH),NG1745 (nuoG),
NG1746 (nuoF),NG1747 (nuoE),NG1748 (nuoD nuoC),NG1749 (nuoD nuoC),NG1750 (nuoB),NG1751 (nuoA).


Oklahoma ID: NGO.1741c

Blast Summary:  PSI-Blast Search
Residues 1-101 are 100% similar to NADH dehydrogenase chain I,K subunit from Neisseria meningitidis group B strain MD58 and group A strain Z2491 (pir||A81220).

Numerous hits in gapped BLAST to NADH ubiquinone oxidoreductase sequences,e.g. residues 1-101 are 76% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa strain 9a5c (gb|AAF83126.1|).Residues 1-101 are 35% similar to NADH dehydrogenase I, chain K from Escherichia coli strain K-12 (pir||E64999).Residues 2-101 are 38% similar to NADH dehydrogenase I chain K from Pseudomonas aeruginosa strain PAO1 (gb|AAG06034.1|).


COGS Summary:  COGS Search
BeTs to 6 clades of COG0713
COG name: NADH-ubiquinone oxidoreductase subunit 11 or 4L (chain K), NuoK/NQO11/Nad4L
Functional Class:  C
The phylogenetic pattern of COG0713 is -----Q-ce-r-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001133 (NADH-ubiquinone oxidoreductase chain 4L) with a combined E-value of 2.2e-32.
    IPB001133A    15-45
    IPB001133B    63-101


ProDom Summary:  Protein Domain Search
Residues 25-93 are 60% similar to a (OXIDOREDUCTASE CHAIN DEHYDROGENASE UBIQUINONE 4L NAD) protein domain (PD002107) which is seen in NQOB_PARDE.



Paralogs:  Local Blast Search


NG1741 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 101 (E-value = 1.8e-40) place NG1741 in the Oxidored_q2 family which is described as NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
101
cleavable N-terminal sequence  
1  
21
transmembrane  
29  
45
transmembrane  
61  
77

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MITLTHYLVLGALLFGISAMGIFMNRKNVLVLLMSIELMLLAVNFNFIAF
SQHLGDTAGQIFVFFVLTVAAAESAIGLAIMVLVYRNRQTINVADLDELK
G

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTACTTTGACGCATTATCTGGTATTGGGCGCTCTCCTGTTCGGTAT
CAGCGCGATGGGCATCTTTATGAACCGCAAAAACGTGCTGGTATTGCTGA
TGTCCATCGAGCTGATGCTTTTGGCGGTGAACTTCAACTTTATCGCCTTC
TCGCAACATTTGGGCGATACTGCCGGACAAATTTTCGTATTCTTCGTATT
GACCGTTGCCGCTGCCGAATCTGCCATCGGTTTGGCGATTATGGTGCTGG
TGTACCGCAACCGACAAACGATTAATGTTGCCGATTTGGACGAGTTGAAA
GGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy