Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1420 IGR1418 IGR1421 IGR1422 IGR1419 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoN, - NG1737 nuoM, - NG1738 nuoL, - NG1740 nuoG, - NG1745 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoN, - NG1737 nuoM, - NG1738 nuoL, - NG1740 nuoG, - NG1745 nuoK, - NG1741 nuoI, - NG1743 nuoJ, - NG1742 nuoH, - NG1744 nuoN, - NG1737 nuoM, - NG1738 nuoL, - NG1740 nuoG, - NG1745 NG1739 NG1739
* Calculated from Protein Sequence

Gene ID: NG1740

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoL  

Definition:
NADH dehydrogenase I chain L (ubiquinone oxidoreductase)

Gene Start:
1701867

Gene Stop:
1699846

Gene Length:
2022

Molecular Weight*:
74112

pI*:
8.50

Net Charge*:
6.25

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Pereira de Souza,A., Jubier,M.F., Delcher,E., Lancelin,D.and
Lejeune,B.
A trans-splicing model for the expression of the tripartite nad5
gene in wheat and maize mitochondria.
Plant Cell 3 (12),1363-1378 (1991)
Medline: 93005687


Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1737 (nuoN), NG1741 (nuoK),NG1742(nuoJ),NG1743 (nuoI),NG1744 (nuoH),NG1745 (nuoG),
NG1746 (nuoF),NG1747 (nuoE),NG1748 (nuoD nuoC),NG1749 (nuoD nuoC),NG1750 (nuoB),NG1751 (nuoA).

Oklahoma ID: NGO.1740c

Blast Summary:  PSI-Blast Search
Residues 1-674 are 97% similar to NADH dehydrogenase I, L chain of NMB0257 from Neisseria meningitidis group B strain MD58 (gb|AAF40711.1|).

Numerous hits in gapped BLAST to NADH dehydrogenase I,chain L sequences,e.g.residues 6-670 are 54% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa strain 9a5c (gb|AAF83127.1|).Residues 5-665 are 42% similar to NADH dehydrogenase I,chain L subunit from Caulobacter crescentus (gb|AAK23914.1|).

COGS Summary:  COGS Search
BeTs to 8 clades of COG1009
COG name: NADH-ubiquinone oxidoreductase subunit 5 (chain L), NuoL/NQO12/Nad5
Functional Class:  C
The phylogenetic pattern of COG1009 is a----Q-CEBr-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002128 (NADH-Ubiquinone oxidoreductase (complex I), chain 5 from chloroplast) with a combined E-value of 2.4e-86.
    IPB002128B    68-122
    IPB002128C    155-209
    IPB002128D    236-290
    IPB002128E    318-372
    IPB002128F    384-438
    IPB002128H    481-512
***** PR01434 (NADH-ubiquinone oxidoreductase chain 5 signature) with a combined E-value of 1.5e-77.
    PR01434A    85-110
    PR01434B    114-134
    PR01434C    161-182
    PR01434D    238-259
    PR01434E    260-286
    PR01434F    328-340
    PR01434G    433-452
***** IPB001750 (NADH-Ubiquinone/plastoquinone (complex I), various chains) with a combined E-value of 1.2e-17.
    IPB001750A    242-253
    IPB001750B    314-332
***** IPB000260 (NADH-ubiquinone oxidoreductase chain 4, amino terminus) with a combined E-value of 1.3e-07.
    IPB000260D    235-281
    IPB000260E    294-347
    IPB000260F    358-407


ProDom Summary:  Protein Domain Search
Residues 585-665 are 37% similar to a (UBIQUINONE MITOCHONDRION OXIDOREDUCTASE) protein domain (PD004305) which is seen in NQOC_PARDE.

Residues 245-296 are 69% similar to a (NADH DEHYDROGENASE OXIDOREDUCTASE MITOCHONDRION CHAIN) protein domain (PD000084) which is seen in NU5C_MARPO.

Residues 378-452 are 38% similar to a (PROTEIN MITOCHONDRION TRANSMEMBRANE OXIDOREDUCTASE NAD) protein domain (PD000148) which is seen in Q37024_HANWI.

Residues 378-416 are 64% similar to a (DEHYDROGENASE NADH OXIDOREDUCTASE MITOCHONDRION) protein domain (PD110913) which is seen in NU5M_CHOCR.

Residues 172-244 are 46% similar to a (NADH DEHYDROGENASE MITOCHONDRION OXIDOREDUCTASE) protein domain (PD016228) which is seen in Q9ZCG1_RICPR.

Residues 119-170 are 67% similar to a (MITOCHONDRION NADH OXIDOREDUCTASE DEHYDROGENASE) protein domain (PD000030) which is seen in NUOL_RHOCA.

Residues 296-337 are 66% similar to a (MITOCHONDRION NADH DEHYDROGENASE SUBUNIT OXIDOREDUCTASE) protein domain (PD000029) which is seen in NQOC_PARDE.



Paralogs:  Local Blast Search


NG1740 is paralogously related to NG1737 (probable NADH dehydrogenase I (ubiquinone)) (2e-25) and NG1738 (probable NADH dehydrogenase I, M chain) (1e-21).


Pfam Summary:  Pfam Search
Residues 66 to 126 (E-value = 2.7e-20) place NG1740 in the Oxidored_q1_N family which is described as NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus (PF00662)
Residues 137 to 432 (E-value = 2.3e-102) place NG1740 in the Oxidored_q1 family which is described as NADH-Ubiquinone/plastoquinone (complex I), various chains (PF00361)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
59
cleavable N-terminal sequence  
1  
33
transmembrane  
36  
52
transmembrane  
88  
104
transmembrane  
120  
136
transmembrane  
143  
159
transmembrane  
180  
196
transmembrane  
225  
241
transmembrane  
262  
278
transmembrane  
297  
313
non-globular  
320  
365
transmembrane  
353  
369
transmembrane  
428  
444
transmembrane  
487  
503
transmembrane  
553  
569
transmembrane  
649  
665

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNDMTLYLIIALVPLAGSLIAGLFGNKIGRAGAHTVTILGVAVSAVLSAY
VLWGFLNGSRTKFDENVYTWLTMGGLDFSVGFLVDTMTAMMMVVVTGVSL
MVHIYTIGYMHDEKVGYQRFFSYISLFTFSMLMLIMSNNFIQLFFGWEAV
GLVSYLLIGFYFKRPSATFANLKAFLINRVGDFGFLLGIGLVLAYFGGSL
RYQDVFAYLPNVQNATIQLFPGVEWSLITVTCLLLFVGAMGKSAQFPLHV
WLPDSMEGPTPISALIHAATMVTAGLFMVSRMSPIYEMSSTALSVIMVIG
AITALFMGFLGVIQNDIKRVVAYSTLSQLGYMTVALGASAYSVAMFHVMT
HAFFKALLFLAAGSAIIGMHHDQDMRHMGNLKKYMPITWLTMLIGNLSLI
GTPFFSGFYSKDSIIEAVKYSTLPGSGVAYFAVLASVFVTAFYAFRQYFM
VFHGEEKWRSLPEHHSDGHGEEHHGLGKNDNPHESPLVVTLPLILLAIPS
VIIGYIAIEPMLYGDFFKDVIFVNADAHPTMHIMKEEFHGALAMVSHSLT
SPVLYLAAAGVAAAWLLYVKLPHLPAKIAQAFRPVYVLFENKYYLDALYF
NVFAKGTRALGNFFWKVGDTAIIDNGIVNGSAKLVGAIAAQVRKAQTGFI
YTYAAAMVFGVLVLLGMTFWGLFR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGATATGACTTTATATTTGATAATTGCCCTTGTTCCGTTGGCAGG
CTCGCTGATTGCGGGTTTGTTCGGCAACAAAATCGGGCGTGCCGGCGCGC
ATACGGTTACGATACTCGGTGTCGCTGTATCTGCCGTGCTGTCGGCTTAT
GTGCTGTGGGGATTCCTCAATGGCAGCCGTACCAAGTTTGACGAAAACGT
CTATACCTGGCTGACAATGGGCGGCTTGGATTTTTCCGTCGGCTTCTTGG
TCGATACGATGACGGCGATGATGATGGTCGTGGTAACGGGCGTGTCGTTG
ATGGTGCATATCTATACCATCGGTTATATGCACGATGAAAAAGTCGGCTA
CCAACGCTTCTTCAGCTATATTTCTTTGTTTACTTTCAGCATGTTGATGC
TGATTATGAGCAACAACTTCATCCAGCTCTTCTTCGGTTGGGAAGCGGTG
GGCTTGGTGTCGTATCTCTTGATCGGTTTCTATTTCAAACGTCCGAGCGC
GACATTTGCCAACCTGAAAGCCTTTTTGATCAACCGTGTCGGCGACTTCG
GCTTTTTGCTCGGTATCGGCTTGGTGCTTGCCTATTTCGGCGGCAGCCTG
CGTTATCAGGACGTATTCGCCTATCTGCCCAACGTACAAAATGCCACTAT
CCAGCTTTTCCCCGGCGTGGAATGGTCTTTGATTACCGTAACCTGTTTGC
TCCTGTTTGTCGGTGCGATGGGTAAATCGGCACAATTCCCGCTGCACGTC
TGGCTGCCTGATTCGATGGAAGGCCCGACTCCGATTTCTGCATTGATTCA
CGCCGCGACGATGGTTACCGCCGGTTTGTTTATGGTGTCGCGTATGTCGC
CGATTTATGAGATGAGCAGCACCGCGCTGTCGGTCATTATGGTAATCGGC
GCGATTACCGCCCTGTTTATGGGCTTCTTGGGTGTGATTCAAAACGACAT
CAAACGTGTGGTTGCGTATTCTACCCTGTCGCAACTGGGCTACATGACCG
TGGCTCTGGGCGCGTCCGCCTATTCTGTGGCGATGTTCCACGTCATGACC
CACGCCTTCTTTAAAGCCTTGCTGTTCTTGGCGGCGGGCAGTGCGATTAT
CGGTATGCACCACGATCAAGATATGCGCCATATGGGCAACCTGAAAAAAT
ACATGCCGATTACTTGGCTGACTATGCTGATCGGCAATTTGTCTCTGATC
GGTACGCCGTTCTTCTCCGGCTTCTACTCCAAAGATTCGATTATCGAAGC
AGTGAAATACAGCACCCTGCCGGGCAGCGGCGTTGCCTATTTTGCCGTCC
TCGCCAGCGTGTTCGTTACCGCGTTTTACGCGTTCCGCCAATACTTTATG
GTGTTCCACGGCGAAGAAAAATGGCGCAGCCTGCCCGAACACCATTCAGA
CGGCCATGGTGAAGAACATCACGGCTTGGGCAAAAACGACAATCCGCACG
AAAGCCCGCTGGTCGTTACCCTGCCGCTGATTCTGCTTGCGATTCCGTCC
GTCATCATCGGCTACATCGCCATCGAACCCATGCTCTACGGCGATTTCTT
CAAAGACGTGATTTTCGTCAACGCCGACGCGCATCCGACCATGCACATCA
TGAAAGAAGAGTTCCACGGCGCATTGGCAATGGTGTCGCACAGCTTGACA
TCGCCTGTTTTGTATTTGGCGGCTGCCGGTGTTGCCGCCGCGTGGCTTTT
GTACGTCAAACTGCCGCACCTGCCCGCTAAAATCGCGCAGGCGTTCCGTC
CGGTTTACGTTTTGTTTGAAAACAAATACTACCTCGACGCCTTGTATTTC
AACGTCTTCGCCAAAGGCACGCGCGCATTGGGAAACTTCTTCTGGAAAGT
CGGCGATACCGCCATTATCGACAACGGCATCGTCAACGGCTCCGCCAAAC
TGGTCGGCGCGATTGCCGCTCAGGTACGCAAAGCCCAAACCGGCTTTATC
TACACCTACGCCGCCGCTATGGTGTTCGGCGTATTGGTCTTGCTCGGCAT
GACCTTCTGGGGCTTGTTCAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy