Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1420 IGR1414 IGR1418 IGR1417 IGR1415 IGR1416 IGR1419 nuoK, - NG1741 NG1736 nuoJ, - NG1742 nuoN, - NG1737 nuoM, - NG1738 nuoL, - NG1740 ispA, - NG1735 NG1733 bapA, - NG1732 nuoK, - NG1741 NG1736 nuoJ, - NG1742 nuoN, - NG1737 nuoM, - NG1738 nuoL, - NG1740 ispA, - NG1735 NG1733 bapA, - NG1732 nuoK, - NG1741 NG1736 nuoJ, - NG1742 nuoN, - NG1737 nuoM, - NG1738 nuoL, - NG1740 NG1739 NG1739 ispA, - NG1735 bapA, - NG1732 xseB,ex7s, - NG1734 xseB,ex7s, - NG1734 NG1733
* Calculated from Protein Sequence

Gene ID: NG1738

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoM  

Definition:
probable NADH dehydrogenase I, M chain

Gene Start:
1698505

Gene Stop:
1696889

Gene Length:
1617

Molecular Weight*:
59364

pI*:
10.10

Net Charge*:
11.55

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Xu,X., Matsuno-Yagi,A. and Yagi,T.
DNA sequencing of the seven remaining structural genes of the gene
cluster encoding the energy-transducing NADH-quinone oxidoreductase
Biochemistry 32, 968-981 (1993)
Medline: 93136200

Weidner,U., Geier,S., Ptock,A., Friedrich,T., Leif,H. and Weiss,H.
The gene locus of the proton-translocating NADH: ubiquinone oxidoreductase in Escherichia coli.Organization of the 14 genes
and relationship between the derived proteins and subunits of
mitochondrial complex I.
J. Mol. Biol. 233 (1),109-122 (1993)
Medline: 93389724

Zambrano,M.M. and Kolter,R.
Escherichia coli mutants lacking NADH dehydrogenase I have a
competitive disadvantage in stationary phase.
J. Bacteriol. 175 (17), 5642-5647 (1993)
Medline: 93374861

Fish,L.E., Kuck,U. and Bogorad,L.
Two partially homologous adjacent light-inducible maize chloroplast genes encoding polypeptides of the P700 chlorophyll a-protein complex of photosystem I.
J. Biol. Chem. 260 (3), 1413-1421 (1985)
Medline: 85104999




Comment:
For other 'nuo'genes see NG1737 (nuoN), NG1740 (nuoL), NG1741 (nuoK),NG1742 (nuoJ),NG1743 (nuoI),NG1744 (nuoH),NG1745 (nuoG),
NG1746 (nuoF),NG1747 (nuoE),NG1748 (nuoD nuoC),NG1749 (nuoD nuoC),NG1750 (nuoB),NG1751 (nuoA).

Oklahoma ID: NGO.1738c

Blast Summary:  PSI-Blast Search
Residues 42-539 are 98% similar to NADH dehydrogenase I,M subunit from Neisseria meningitidis MC58 (gb|AAF40712.1|).


Numerous hits in gapped BLAST to NADH dehydrogenase I, M chain (ubiquinone) sequences e.g. residues 47-539 are 56% similar to NADH-ubiquinone oxidoreductase from Xylella fastidiosa (gb|AAF83128.1|).Residues 47-530 are 35% similar to NADH dehydrogenase I chain M from Escherichia coli K12 (gb|AAC75337.1|).Residues 111-522 are 38% similar to NADH dehydrogenase I chain M from Pseudomonas aeruginosa strain PAO1
(gb|AAG06036.1|).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1008
COG name: NADH-ubiquinone oxidoreductase subunit 4 (chain M), NuoM/NQO13/Nad4
Functional Class:  C
The phylogenetic pattern of COG1008 is -----Q-Ce-r-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR01437 (NADH-ubiquinone oxidoreductase subunit 4 signature) with a combined E-value of 6.4e-62.
    PR01437A    179-198
    PR01437B    209-233
    PR01437C    279-303
    PR01437D    372-391
    PR01437E    424-450
***** IPB000260 (NADH-ubiquinone oxidoreductase chain 4, amino terminus) with a combined E-value of 8.7e-54.
    IPB000260B    124-162
    IPB000260C    173-216
    IPB000260D    257-303
    IPB000260E    318-371
    IPB000260F    392-441
    IPB000260C    172-215
***** IPB001750 (NADH-Ubiquinone/plastoquinone (complex I), various chains) with a combined E-value of 1.2e-18.
    IPB001750A    264-275
    IPB001750B    338-356


ProDom Summary:  Protein Domain Search
Residues 319-480 are 31% similar to a (PROTEIN MITOCHONDRION TRANSMEMBRANE OXIDOREDUCTASE NAD) protein domain (PD000148) which is seen in O47572_ONCVO.

Residues 266-305 are 55% similar to a (PROTEIN OXIDOREDUCTASE NADH-UBIQUINONE) protein domain (PD033371) which is seen in O25862_HELPY.

Residues 411-498 are 46% similar to a (MITOCHONDRION UBIQUINONE OXIDOREDUCTASE NADH) protein domain (PD000729) which is seen in NUOM_RHOCA.

Residues 155-217 are 60% similar to a (MITOCHONDRION NADH OXIDOREDUCTASE DEHYDROGENASE) protein domain (PD000030) which is seen in NQOD_PARDE.

Residues 375-407 are 66% similar to a (MITOCHONDRION UBIQUINONE OXIDOREDUCTASE NADH CHAIN NAD) protein domain (PD186032) which is seen in NUOM_RHOCA.

Residues 319-361 are 65% similar to a (MITOCHONDRION NADH DEHYDROGENASE SUBUNIT OXIDOREDUCTASE) protein domain (PD000029) which is seen in O67341_AQUAE.

Residues 102-142 are 51% similar to a (OXIDOREDUCTASE DEHYDROGENASE NADH CHAIN NAD) protein domain (PD002270) which is seen in O33750_SYNP2.



Paralogs:  Local Blast Search


NG1738 is paralogously related to NG1740 (NADH dehydrogenase I chain L (ubiquinone oxidoreductase)) (1e-21) and NG1737 (probable NADH dehydrogenase I (ubiquinone)) (1e-20).


Pfam Summary:  Pfam Search
Residues 173 to 464 (E-value = 3.3e-101) place NG1738 in the Oxidored_q1 family which is described as NADH-Ubiquinone/plastoquinone (complex I), various chains (PF00361)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
47  
102
transmembrane  
47  
63
transmembrane  
76  
92
transmembrane  
128  
144
transmembrane  
157  
173
transmembrane  
177  
193
transmembrane  
209  
225
transmembrane  
252  
268
transmembrane  
319  
335
transmembrane  
380  
396
non-globular  
410  
462
transmembrane  
443  
459
transmembrane  
499  
515

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
LGISKEGGRVFIPSFRRLPKTLSVKTNPYNYIFYFNHRLTTMFSNYLLSL
AIWIPIAAGVLVLATGKDSRAPLARVLAFMGALAGFLVTLPLFTGFDRLS
GGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLAGWEVIQ
KRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGP
RRVYASVKLFLYTLTGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQ
QLLFVAFFLSFAVKVPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYG
FLRFILPIMPDAARYFAPVIIVLSLIAVIYIGMVALVQTDMKKLVAYSSI
SHMGFVTLGMFLFVDGQLDDWALKGAVIQMISHGFVSAAMFMCIGVMYDR
LHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFMVVMGAV
KVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFA
ILAVLAVAVLGMGLYPNAFIEVVHQAANDLIAHVAQSKI

Gene Nucleotide Sequence:  Sequence Viewer
TTGGGAATAAGTAAAGAAGGGGGGAGAGTATTCATTCCTTCTTTCAGACG
ACTTCCTAAAACGCTGTCTGTAAAGACCAACCCATACAACTATATTTTTT
ATTTTAACCACAGGTTAACCACTATGTTTTCCAACTACCTACTCAGCTTG
GCAATATGGATACCCATCGCCGCAGGCGTGCTGGTTTTGGCGACCGGTAA
AGACAGCCGTGCGCCGCTGGCGCGTGTGCTTGCCTTCATGGGAGCGCTTG
CCGGTTTCTTGGTAACGCTGCCCCTGTTTACCGGTTTCGACCGTTTGAGC
GGCGGCTATCAATTTACCGAGTTCCACGAGTGGATTCCGCTTCTGAAAAT
CAACTACGCATTGGGCGTGGACGGTATTTCAGTGCTCTTTATCATCTTGA
ATGCGTTTATTACGCTGCTGGTGGTATTGGCCGGTTGGGAAGTCATTCAG
AAACGTCCGGCGCAGTATATGGCGGCATTCCTGATGATGTCGGGTTTGAT
TAACGGCGCGTTTGCCGCGCAGGATGCGATTCTGTTTTATGTGTTCTTCG
AGGGTATGCTGATTCCGCTGTACCTGATTATCGGTGTATGGGGCGGCCCG
CGCCGCGTCTATGCGTCGGTCAAGCTGTTCCTCTATACGCTGACGGGTTC
GCTCTTGATGTTGGTTGCCATGGTTTACCTGTACTATCAGACAGGCAGCT
TCTCTATTGTCGATTTCCAAAACATCAAACAGATTCCGTTGGGCGTACAA
CAGCTTTTGTTTGTAGCGTTCTTCCTGTCATTTGCCGTAAAAGTGCCGAT
GTTCCCCGTACACACTTGGCTGCCGGATGCCCACGTTGAAGCGCCGACCG
GCGGTTCGATGGTGTTGGCGGCAATTACGCTGAAACTGGGTGCGTATGGT
TTCTTGCGCTTTATCCTGCCGATTATGCCGGACGCGGCTCGCTATTTTGC
CCCCGTAATCATCGTATTGAGCCTGATTGCCGTAATTTATATCGGTATGG
TGGCCCTGGTGCAAACCGATATGAAGAAACTGGTGGCGTATTCGTCCATC
AGCCATATGGGTTTTGTAACGCTTGGGATGTTTTTGTTTGTTGACGGGCA
GTTGGACGACTGGGCGTTGAAAGGCGCGGTCATTCAGATGATTTCGCACG
GCTTCGTGTCGGCGGCGATGTTTATGTGCATCGGCGTGATGTACGACCGC
CTGCACACGCGCAATATTGCCGATTACGGCGGCGTGGTCAATGTGATGCC
CAAGTTTGCGGCGTTTATGATGTTGTTCGGTATGGCGAACGCCGGCCTGC
CTGCGACTTCCGGCTTCGTGGGCGAGTTTATGGTGGTTATGGGCGCGGTC
AAAGTGAATTTCTGGGTGGGCGCGCTGGCGGCTATGACGCTGATTTACGG
CGCGTCTTATACCCTGTGGATGTACAAGCGCGTGATTTTCGGCGCGATTC
ACAATCCGCACGTTGCCGAAATGAAAGACATCAATTGCCGCGAGTTTGCG
ATTCTGGCGGTTTTGGCGGTTGCTGTTTTGGGGATGGGCCTGTATCCGAA
CGCATTTATCGAAGTGGTGCATCAGGCGGCAAACGATTTGATTGCCCATG
TGGCGCAAAGCAAGATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy