Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1414 IGR1418 IGR1417 IGR1415 IGR1416 IGR1419 NG1736 nuoN, - NG1737 nuoM, - NG1738 nuoL, - NG1740 ispA, - NG1735 NG1733 bapA, - NG1732 NG1736 nuoN, - NG1737 nuoM, - NG1738 nuoL, - NG1740 ispA, - NG1735 NG1733 bapA, - NG1732 NG1736 nuoN, - NG1737 nuoM, - NG1738 nuoL, - NG1740 NG1739 NG1739 ispA, - NG1735 NG1733 bapA, - NG1732 xseB,ex7s, - NG1734 xseB,ex7s, - NG1734
* Calculated from Protein Sequence

Gene ID: NG1737

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nuoN  

Definition:
probable NADH dehydrogenase I (ubiquinone)

Gene Start:
1696876

Gene Stop:
1695434

Gene Length:
1443

Molecular Weight*:
51823

pI*:
7.20

Net Charge*:
0.78

EC:
1.6.5.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Xu,X., Matsuno-Yagi,A. and Yagi,T.
DNA sequencing of the seven remaining structural genes of the gene cluster encoding the energy-transducing NADH-quinone oxidoreductase.
Biochemistry 32, 968-981 (1993)
Medline: 93136200

Dupuis,A.,Peinnequin,A., Chevallet,M., Lunardi,J., Darrouzet,E.,
Pierrard,B., Procaccio,V. and Issartel,J.P.
Identification of five Rhodobacter capsulatus genes encoding the
equivalent of ND subunits of the mitochondrial NADH-ubiquinone
oxidoreductase
Gene 167(1/2), 99-104 (1995)

Weidner,U., Geier,S., Ptock,A., Friedrich,T., Leif,H. and Weiss,H.
The gene locus of the proton-translocating NADH: ubiquinone
oxidoreductase in Escherichia coli. Organization of the 14 genes
and relationship between the derived proteins and subunits of
mitochondrial complex I.
J.Mol.Biol. 233 (1),109-122 (1993)
Medline: 93389724



Comment:
For other 'nuo'genes see NG1738 (nuoM), NG1740 (nuoL), NG1741 (nuoK),NG1742 (nuoJ),NG1743 (nuoI),NG1744 (nuoH),NG1745 (nuoG),
NG1746 (nuoF),NG1747 (nuoE),NG1748 (nuoD nuoC),NG1749 (nuoD nuoC),NG1750 (nuoB),NG1751 (nuoA).
Oklahoma ID: NGO.1737c

Blast Summary:  PSI-Blast Search
Residues 1-481 are 96% similar to NADH dehydrogenase chain N, from Neisseria meningitidis group A strain Z2491 (11253439).

Numerous hits in gapped BLAST to NADH dehydrogenase sequences,e.g. residues 4-476 are 45% similar to NADH-ubiquinone oxidoreductase, NQO14 subunit from Xylella fastidiosa strain 9a5c (gb|AAF83129.1|).
Residues 73-470 are 33% similar to NADH dehydrogenase I,subunit nuoN from Escherichia coli (emb|CAA48373.1|).Residues 78-471 are 35% similar to NADH dehydrogenase I chain N from Pseudomonas
aeruginosa strain PAO1 (gb|AAG06037.1|).


COGS Summary:  COGS Search
BeTs to 6 clades of COG1007
COG name: NADH-ubiquinone oxidoreductase subunit 2 (chain N), NuoN/NQO14/Nad2
Functional Class:  C
The phylogenetic pattern of COG1007 is -----Q-ce-r-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001750 (NADH-Ubiquinone/plastoquinone (complex I), various chains) with a combined E-value of 1.8e-18.
    IPB001750A    220-231
    IPB001750B    294-312
***** IPB002128 (NADH-Ubiquinone oxidoreductase (complex I), chain 5 from chloroplast) with a combined E-value of 5.4e-09.
    IPB002128C    143-197
    IPB002128E    298-352
    IPB002128F    366-420


ProDom Summary:  Protein Domain Search
Residues 238-432 are 27% similar to a (PROTEIN MITOCHONDRION TRANSMEMBRANE OXIDOREDUCTASE NAD) protein domain (PD000148) which is seen in NU2M_PODAN.

Residues 107-195 are 37% similar to a (MITOCHONDRION NADH OXIDOREDUCTASE DEHYDROGENASE) protein domain (PD000030) which is seen in NQOE_PARDE.

Residues 378-434 are 59% similar to a (DEHYDROGENASE OXIDOREDUCTASE NADH CHAIN MITOCHONDRION) protein domain (PD006756) which is seen in NUON_RHOCA.

Residues 199-434 are 20% similar to a (NADH DEHYDROGENASE SUBUNIT 2) protein domain (PD087614) which is seen in O21048_DICDI.

Residues 206-239 are 64% similar to a (MITOCHONDRION DEHYDROGENASE NADH SUBUNIT OXIDOREDUCTASE) protein domain (PD002342) which is seen in NUON_RHOCA.



Paralogs:  Local Blast Search


NG1737 is paralogously related to NG1740 (NADH dehydrogenase I chain L (ubiquinone oxidoreductase)) (1e-25) and NG1738 (probable NADH dehydrogenase I, M chain) (9e-21).


Pfam Summary:  Pfam Search
Residues 125 to 415 (E-value = 7.9e-74) place NG1737 in the Oxidored_q1 family which is described as NADH-Ubiquinone/plastoquinone (complex I), various chains (PF00361)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
31
transmembrane  
42  
58
transmembrane  
78  
94
non-globular  
104  
224
transmembrane  
113  
129
transmembrane  
132  
148
transmembrane  
164  
180
transmembrane  
208  
224
transmembrane  
251  
267
non-globular  
273  
481
transmembrane  
276  
292
transmembrane  
311  
327
transmembrane  
331  
347
transmembrane  
368  
384
transmembrane  
405  
421
transmembrane  
450  
466

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNWSDLNLMPALPEVALLSLLVLLLPADLWASDDKCRWTHYGALATVAVT
AAVQLAVWEQGSTSSFNGMYIADGMSRLAKMVLYALTFVLFVYAKPYNQV
RGIFKGEFYTLSLFALLGMSVMVSAGHFLTAYIGLELLSLALYALIALRR
DSGFAAEAALKYFVLGALASGLLLYGISMVYGATGSLEFAGVLASSFNEE
ANEWLLKLGLVFIVVAVAFKLGAVPFHMWMPDVYHGAPTSVTALVGTAPK
IAAVVFAFRILVTGLGTVHHDWSLMFALLAAASLLVGNLAAIMQTNIKRM
LAYSTVSHMGFILLAFMAGAVGFAAGLYYAITYALMAAAGFGVLMVLSDG
DNECENISDLAGLNQHRVWLAFLMLLVMFSMAGIPPLMGFYAKFGVIMAL
LKQGYVWLSVFAVVMSLVGAFYYLRVVKVMYFDESGRARPAAGGNNAAKS
LLSVNALLLVLWGIMPQTVIDWCAKALENTL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTGGTCAGATTTGAATTTAATGCCCGCACTGCCCGAAGTCGCGCT
GCTGTCGCTGCTGGTGTTATTGTTGCCGGCGGACTTGTGGGCCAGTGATG
ACAAATGCCGTTGGACGCATTACGGCGCGTTGGCAACGGTGGCGGTTACG
GCGGCGGTGCAGCTTGCCGTGTGGGAACAGGGCAGCACGTCTTCGTTCAA
CGGGATGTATATTGCGGACGGTATGTCGCGTTTGGCAAAAATGGTTTTAT
ATGCCTTGACGTTTGTCCTGTTTGTCTATGCCAAGCCCTACAACCAAGTG
CGCGGTATTTTCAAAGGCGAGTTTTACACCCTGTCGCTGTTTGCCCTCTT
GGGCATGAGCGTGATGGTGAGCGCGGGGCATTTTTTAACTGCCTATATCG
GTTTGGAACTCTTGTCGCTCGCCCTTTACGCCCTGATTGCCCTGCGCCGC
GATTCCGGTTTTGCCGCCGAAGCCGCCTTGAAATATTTTGTTCTGGGCGC
GCTGGCATCCGGCCTGCTGCTCTACGGTATTTCTATGGTTTACGGCGCAA
CCGGTTCGCTGGAATTTGCCGGCGTGCTCGCCTCTTCCTTCAATGAAGAA
GCTAACGAATGGCTGTTGAAACTGGGTCTGGTGTTTATCGTCGTCGCCGT
TGCGTTCAAACTCGGCGCGGTACCGTTCCATATGTGGATGCCCGACGTGT
ATCACGGCGCGCCCACTTCTGTTACCGCCTTGGTCGGCACTGCCCCGAAA
ATCGCCGCCGTCGTTTTCGCTTTCCGCATCCTCGTTACCGGGCTGGGAAC
CGTGCATCATGACTGGTCTCTGATGTTTGCCCTGCTTGCCGCCGCCTCGC
TGCTGGTCGGCAACCTTGCCGCCATCATGCAGACCAATATCAAACGTATG
CTCGCCTATTCCACCGTATCGCATATGGGTTTCATCCTGTTGGCGTTTAT
GGCGGGCGCGGTCGGCTTTGCGGCGGGCCTCTATTACGCCATTACCTACG
CGCTGATGGCGGCGGCAGGGTTCGGCGTGTTGATGGTGTTGTCGGACGGG
GACAACGAGTGCGAAAACATCAGCGATTTGGCAGGGTTGAACCAACACCG
CGTATGGCTTGCCTTTTTGATGCTGCTGGTTATGTTCTCTATGGCGGGCA
TTCCGCCGCTGATGGGTTTTTACGCCAAATTCGGCGTTATTATGGCGCTT
TTGAAACAAGGCTATGTATGGTTGTCGGTGTTTGCCGTCGTGATGTCGCT
GGTTGGCGCGTTCTACTACCTGCGCGTGGTCAAAGTCATGTATTTTGACG
AATCCGGCCGCGCCCGTCCCGCCGCCGGCGGCAACAATGCCGCAAAATCC
CTCTTAAGCGTCAACGCGCTGCTGTTGGTGCTGTGGGGCATTATGCCGCA
AACCGTTATCGACTGGTGCGCCAAGGCGTTGGAGAACACGCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy