Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1412 IGR1414 IGR1418 IGR1413 IGR1417 IGR1410 IGR1411 IGR1415 IGR1416 NG1736 nuoN, - NG1737 nuoM, - NG1738 NG1731 NG1729 ruvA, - NG1730 NG1728 ispA, - NG1735 NG1733 bapA, - NG1732 NG1736 nuoN, - NG1737 nuoM, - NG1738 NG1731 NG1729 ruvA, - NG1730 NG1728 ispA, - NG1735 NG1733 bapA, - NG1732 NG1736 nuoN, - NG1737 nuoM, - NG1738 NG1739 NG1739 ruvA, - NG1730 NG1728 ispA, - NG1735 NG1733 bapA, - NG1732 xseB,ex7s, - NG1734 xseB,ex7s, - NG1734 NG1731 NG1729
* Calculated from Protein Sequence

Gene ID: NG1735

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ispA  

Definition:
geranylgeranyl pyrophosphate synthase; farnesyl-diphosphate synthase

Gene Start:
1694007

Gene Stop:
1694900

Gene Length:
894

Molecular Weight*:
31689

pI*:
5.70

Net Charge*:
-5.45

EC:
2.5.1.10  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Sterol biosynthesis
Terpenoid biosynthesis

Secondary Evidence:
Fujisaki,S.,Hara,H.,Nishimura,Y.,Horiuchi,K.and Nishino,T.

Cloning and nucleotide sequence of the ispA gene responsible for farnesyl diphosphate synthase activity in Escherichia coli
J.Biochem.108 (6),995-1000 (1990)
Medline: 91210228

Zhu,X.F., Suzuki,K., Okada,K., Tanaka,K., Nakagawa,T.,Kawamukai,M.
and Matsuda,K.
Cloning and functional expression of a novel geranylgeranyl
pyrophosphate synthase gene from Arabidopsis thaliana in
Escherichia coli
Plant Cell Physiol. 38 (3), 357-361 (1997)
Medline: 97294934




Comment:
For other 'isp' genes see NG0971 (ispF), NG0972 and
NG1675 (ispB).

Oklahoma ID: NGO.1735

Blast Summary:  PSI-Blast Search
Residues 1-298 are 93% similar to geranyltranstransferase sequence from Neisseria meningitidis group A strain Z2491 (emb|CAB85437.1|)

Numerous hits in gapped BLAST to geranyltranstransferase (farnesyl-diphosphate synthase) sequences,e.g.residues 7-297 are 52% similar to geranyltranstransferase sequence from Pseudomonas aeruginosa strain PAO1 (gb|AAG07430.1|).Residues 38-296 are 51% similar to geranyltranstransferase from Escherichia coli K12 (gb|AAC73524.1|).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0142
COG name: Geranylgeranyl pyrophosphate synthase
Functional Class:  H
The phylogenetic pattern of COG0142 is AmtkYQVCEBRHUJ--olinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000092 (Polyprenyl synthetase) with a combined E-value of 5.8e-41.
    IPB000092A    47-56
    IPB000092B    77-88
    IPB000092C    91-106
    IPB000092D    159-164
    IPB000092E    217-239


ProDom Summary:  Protein Domain Search
Residues 77-223 are 51% similar to a (SYNTHASE PYROPHOSPHATE TRANSFERASE SYNTHETASE) protein domain (PD000572) which is seen in ISPA_ECOLI.

Residues 225-272 are 62% similar to a (SYNTHASE PYROPHOSPHATE SYNTHETASE TRANSFERASE) protein domain (PD169539) which is seen in ISPA_RHISN.



Paralogs:  Local Blast Search


NG1735 is paralogously related to NG1675 (octaprenyl-diphosphate synthase (IspB)) (6e-26).


Pfam Summary:  Pfam Search
Residues 36 to 294 (E-value = 1.9e-81) place NG1735 in the polyprenyl_synt family which is described as Polyprenyl synthetase (PF00348)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
172  
261

PDB Hit:
pdb|1UBX|1UBX STRUCTURE OF FARNESYL PYROPHOSPHATE SYNTHETASE 40.2 4e-04
pdb|1FPS|1FPS AVIAN FARNESYL DIPHOSPHATE SYNTHASE (FPS) 39.9 6e-04
pdb|1UBX|1UBX STRUCTURE OF FARNESYL PYROPHOSPHATE SYNTHETASE 40.7 3e-04
pdb|1FPS|1FPS AVIAN

Gene Protein Sequence:
LNPTNDLKAWQQRAQAQTELLLERFLPSGNEIPHTLHEAMRYAALDGGKR
LRPMLVLAASELGGAMADAVGQAMAAIEMIHVYSLVHDDMPAMDNDSLRR
GKPTCHIKYGEATALLTGDALQTQAFDVLSRPTELPAARQLAMLSVLAKA
GGSAGMAGGQAIDLANVGKQMVQADLERMHSLKTGALIRAAVLLGATACP
DLSDAELAVLDAYAAKLGLAFQVIDDVLDCEADTATLGKTAGKDADNDKP
TYVKLMGLEAARSYAHKLVAEAVALLEPFGDKALRLRQLAEFAVARKY

Gene Nucleotide Sequence:  Sequence Viewer
TTGAATCCGACGAATGATTTGAAAGCGTGGCAACAGAGGGCGCAGGCGCA
GACAGAGCTGCTGCTGGAACGCTTTTTGCCGTCTGGAAACGAAATCCCGC
ACACGCTGCACGAAGCGATGCGCTATGCGGCTTTGGACGGCGGCAAGCGT
CTGCGCCCGATGCTGGTGCTGGCGGCTTCGGAATTGGGCGGGGCCATGGC
GGATGCGGTCGGACAGGCAATGGCGGCAATCGAAATGATCCACGTCTATT
CTTTGGTTCACGACGATATGCCGGCGATGGACAACGACAGCCTGCGGCGC
GGCAAACCGACCTGCCACATCAAATATGGCGAAGCCACCGCCCTTCTGAC
CGGCGACGCTTTACAAACCCAAGCCTTCGACGTGTTGAGCCGTCCGACAG
AACTGCCCGCCGCACGCCAGTTGGCAATGTTGTCGGTGTTGGCAAAAGCG
GGCGGCAGCGCGGGTATGGCGGGCGGACAGGCAATCGATTTGGCAAATGT
CGGCAAACAAATGGTTCAAGCCGATTTGGAACGGATGCACAGCCTGAAAA
CGGGGGCGTTGATCCGTGCGGCGGTTTTATTGGGGGCGACGGCGTGTCCC
GATCTGTCCGACGCGGAACTTGCCGTATTGGACGCTTACGCGGCAAAACT
GGGTTTGGCGTTCCAAGTCATCGACGATGTGTTGGATTGTGAAGCGGACA
CGGCGACTTTGGGCAAGACGGCGGGCAAAGATGCCGACAACGACAAGCCG
ACTTATGTGAAACTGATGGGCTTGGAAGCGGCGCGCTCATACGCACACAA
ACTGGTTGCCGAAGCAGTCGCGCTGCTCGAACCCTTCGGCGACAAAGCCC
TGCGCCTGCGGCAGTTGGCAGAATTTGCAGTCGCACGCAAATAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy