Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1404 IGR1406 IGR1405 IGR1403 IGR1407 IGR1402 NG1720 bioH, - NG1725 NG1724 NG1723 comF, - NG1726 trpC, - NG1721 NG1719 mviN, - NG1718 recQ, - NG1722 NG1720 bioH, - NG1725 NG1724 NG1723 comF, - NG1726 trpC, - NG1721 NG1719 mviN, - NG1718 recQ, - NG1722 NG1720 bioH, - NG1725 NG1724 NG1723 comF, - NG1726 trpC, - NG1721 NG1719 mviN, - NG1718 recQ, - NG1722
* Calculated from Protein Sequence

Gene ID: NG1722

DNA Molecule Name:
1  

Genbank ID:
4105528

Gene Name:
recQ  

Definition:
ATP-dependent DNA helicase (RecQ)

Gene Start:
1682061

Gene Stop:
1684361

Gene Length:
2301

Molecular Weight*:
86093

pI*:
7.00

Net Charge*:
0.00

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Primary Evidence:
Mehr,I.J. and Seifert,H.S.,
Differential roles of homologous recombination pathways in
Neisseria gonorrhoeae pilin antigenic variation, DNA
transformation and DNA repair,
Mol. Microbiol. 30 (4), 697-710 (1998)
Medline: 99140429


Secondary Evidence:
Irino,N., Nakayama,K. and Nakayama,H.
The recQ gene of Escherichia coli K12: Primary structure and
evidence for SOS regulation
Mol. Gen. Genet. 205, 298-304 (1986)
Medline: 87115164


Comment:
Oklahoma ID: NGO.1722

For other 'rec' genes, see NG0318 (recN), NG0370 (recB), NG0414 (recJ), NG0741 (recA), NG0767 (recR), NG0771 (recD), NG1053 (recX), NG1369 (recC), NG1509 (recO), NG0117 (recG).

Blast Summary:  PSI-Blast Search
NG1722 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 4105528.

Residues 3-767 in NG1722 have 95% similarity to residues 2-766 in AE002384, N. meningitidis MC58 ATP-dependent DNA helicase RecQ.

Numerous hits in gapped BLAST to ATP-dependent DNA helicase RecQ sequences,e.g.residues 7-759 in NG1722 have 43% similarity to residues 12-815 in AE001976, D.radiodurans DNA helicase RecQ.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0514
COG name: Superfamily II DNA helicases, RecQ family
Functional Class:  L
The phylogenetic pattern of COG0514 is ----y--ceB-h-----l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000629 (ATP-dependent helicase, DEAD-box) with a combined E-value of 2.6e-08.
    IPB000629A    16-59
    IPB000629E    288-329


ProDom Summary:  Protein Domain Search
Residues 347-503 are identical to a (HELICASE ATP-BINDING DNA PROTEIN) protein domain (PD007610) which is seen in Q9ZHY4_NEIGO.

Residues 7-91 are identical to a (HELICASE DNA ATP-BINDING PROTEIN ATP-DEPENDENT) protein domain (PD100086) which is seen in Q9ZHY4_NEIGO.

Residues 698-761 are 98% similar to a (RECQ DNA HELICASE DNA-BINDING ATP-BINDING HOMOLOG) protein domain (PD013646) which is seen in Q9ZHY4_NEIGO.

Residues 226-345 are identical to a (HELICASE PROTEIN POLYPROTEIN ATP-BINDING RNA RNA-BINDING) protein domain (PD000033) which is seen in Q9ZHY4_NEIGO.

Residues 111-214 are 84% similar to a (HELICASE PROTEIN ATP-BINDING DNA ATP-DEPENDENT SYNDROME) protein domain (PD003883) which is seen in Q9ZHY4_NEIGO.



Paralogs:  Local Blast Search


NG1722 is paralogously related to NG0149 (ATP-dependent RNA helicase RhlE) (1e-07) and NG0650 (ATP-dependent RNA helicase) (7e-07).


Pfam Summary:  Pfam Search
Residues 10 to 212 (E-value = 3.4e-32) place NG1722 in the DEAD family which is described as DEAD/DEAH box helicase (PF00270)
Residues 250 to 326 (E-value = 1.7e-27) place NG1722 in the Helicase_C family which is described as Helicase conserved C-terminal domain (PF00271)
Residues 525 to 605 (E-value = 2.1e-33) place NG1722 in the HRDC family which is described as HRDC domain (PF00570)
Residues 613 to 691 (E-value = 3.6e-28) place NG1722 in the HRDC family which is described as HRDC domain (PF00570)
Residues 692 to 766 (E-value = 3.6e-25) place NG1722 in the HRDC family which is described as HRDC domain (PF00570)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
56  
72
non-globular  
713  
767

PDB Hit:
pdb|1FUU|1FUU-A YEAST INITIATION FACTOR 4A 61.7 5e-10
pdb|1HV8|1HV8-A CRYSTAL STRUCTURE OF A DEAD BOX PROTEIN FROM THE 58.6 4e-09
pdb|1FUK|1FUK-A CRYSTAL STRUCTURE OF THE CARBOXY TERMINAL DOMAIN 55.8 3e-08
pdb|1FUU|1FUU-A YEAS

Gene Protein Sequence:
MTHRPTARQILHEVFGYPEFRGRQEDVINTLAGGGSLTVLMPTGGGKSLC
YQIPALMREGVAVVVSPLIALMNDQVASLHVAGIEAAAVNSGTSADEARE
IADKLAQGRLKLLYVAPERLVTDRFLRFLDQQTVSLFAIDEAHCVSRWGH
DFRPEYQQLGMLAERYPNIPRIALTATADAATRADIKHYLHLDDASEFVS
SFDRTNIYYQVIEKNNGKKQLLDFIRKEMTGQSGIVYCLSRKKVEDAAQF
LRENGLNAIPYHAGLSMDVREENQRRFTHEDNIIVVATVAFGMGIDKPDV
RFVAHLDMPQSVEHFYQESGRAGRDGLPAVSWLCYGLNDWVLLRERIAEG
NSDEVQKQIEMQKLDAMLSVCETAACRRVLLLKHFGEASEPCGHCDNCLH
PPVRFDGTVLVQKLLSCVYRAGQRFAAGYITNLLRGKSDDWIRGNRHEQL
STFGIGAELSDKEWRSVIRQCISLGYLTVNIARYQALQLTEAAKKVLKGE
TEVMLRPLKRDKPATRTLKDNWLRTEREERLWQALRVWRMKQAEAEGIPA
YMIFGDKTLRDLVEKMPQNLNGLHDIYGLGEAKTERFGHGILKVCQNAAD
FSHDAVIRPQTEREQQLRQKLEAWRYEQARAENCALHTVLSDESLADMLA
ATPETETDLEAVHGLGSVRAAKYGRDILAVCRPFSDGIDETAKHKRCLMR
ALIQWCNETAKHEQSEPYRILSKAALRAIAAKQPEGLAELAAVYGVGEEK
AARYGAAVLAVLERDAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGCACCGACCCACCGCCAGACAGATTTTGCACGAAGTATTCGGCTA
TCCCGAATTTCGCGGCAGGCAGGAGGATGTCATCAATACTTTGGCAGGCG
GCGGCAGTTTGACGGTGCTGATGCCGACGGGCGGGGGCAAGTCTTTGTGT
TACCAGATTCCGGCGCTGATGCGCGAAGGCGTGGCGGTTGTCGTATCGCC
GCTGATTGCGCTGATGAACGACCAAGTGGCCAGCCTGCATGTGGCCGGGA
TTGAAGCGGCGGCAGTCAACAGCGGCACATCGGCAGATGAGGCGCGCGAG
ATTGCCGACAAGCTTGCCCAAGGCCGTCTGAAGCTGCTTTATGTCGCGCC
GGAACGCTTGGTTACCGACCGCTTTTTACGTTTTCTCGACCAACAAACCG
TCAGCCTGTTCGCCATTGACGAAGCGCACTGCGTCAGCCGGTGGGGACAC
GATTTCCGCCCCGAATATCAACAGCTCGGTATGCTTGCCGAACGCTATCC
GAACATCCCGCGCATCGCCCTGACCGCCACCGCCGATGCCGCCACGCGCG
CCGACATCAAGCATTATCTGCACTTGGACGACGCGTCCGAATTTGTCTCC
AGCTTTGACCGCACGAATATTTATTATCAGGTTATCGAAAAAAACAACGG
CAAAAAACAATTGCTGGATTTCATCCGCAAAGAAATGACGGGGCAAAGCG
GCATTGTGTATTGCCTAAGCCGCAAAAAGGTTGAAGATGCGGCGCAGTTT
TTGCGTGAAAACGGATTAAACGCGATTCCGTATCATGCCGGTTTGAGCAT
GGACGTGCGCGAGGAAAACCAACGCCGCTTTACGCATGAAGACAATATTA
TCGTGGTGGCGACCGTGGCGTTCGGCATGGGCATAGACAAACCCGACGTG
CGCTTTGTCGCCCATCTCGATATGCCCCAGAGTGTCGAACATTTCTATCA
GGAATCAGGGCGCGCCGGCCGGGACGGGCTGCCTGCCGTGAGTTGGCTGT
GTTACGGCTTGAACGATTGGGTGTTGCTGCGCGAACGGATTGCCGAAGGC
AACAGCGACGAGGTGCAAAAGCAAATCGAAATGCAAAAACTCGATGCCAT
GCTTTCCGTCTGCGAAACCGCCGCCTGCCGCCGCGTACTGCTGCTCAAAC
ATTTCGGCGAAGCATCCGAACCCTGCGGACATTGTGACAACTGCCTGCAT
CCGCCCGTACGGTTTGACGGCACGGTGTTGGTGCAAAAATTACTCAGCTG
CGTGTACCGCGCCGGACAACGCTTTGCCGCCGGTTACATCACCAACCTTT
TGCGCGGCAAAAGCGACGATTGGATACGCGGCAACCGGCACGAGCAACTG
TCCACATTCGGCATCGGCGCGGAATTGTCCGACAAAGAATGGCGCAGCGT
CATCCGCCAGTGCATCAGCCTCGGCTACCTCACCGTCAACATTGCCCGAT
ATCAGGCATTGCAACTGACCGAAGCCGCCAAAAAAGTCCTCAAAGGCGAA
ACCGAAGTGATGCTGCGCCCGCTCAAGCGCGACAAGCCCGCCACCCGCAC
CCTCAAAGACAACTGGCTGCGTACCGAACGCGAAGAACGCCTGTGGCAGG
CATTGCGCGTTTGGCGCATGAAACAGGCTGAAGCCGAAGGCATCCCCGCC
TATATGATTTTCGGCGACAAAACCCTGCGCGACCTTGTCGAAAAAATGCC
GCAAAACCTCAACGGGCTGCACGACATCTACGGCTTGGGCGAAGCCAAAA
CCGAACGTTTCGGACACGGCATACTCAAAGTCTGCCAAAACGCTGCCGAC
TTTAGCCACGATGCCGTCATCCGTCCGCAAACCGAACGCGAACAACAACT
GCGTCAAAAACTCGAAGCCTGGCGGTATGAACAGGCAAGGGCGGAAAACT
GCGCCCTGCATACCGTCCTCTCCGACGAAAGCCTTGCCGATATGCTTGCC
GCCACGCCCGAAACCGAAACCGACCTCGAAGCCGTACACGGCTTGGGCAG
CGTACGCGCCGCCAAATACGGACGGGACATCCTCGCCGTCTGCCGTCCGT
TTTCAGACGGCATCGATGAAACCGCCAAACACAAACGCTGCCTGATGCGC
GCCCTGATTCAATGGTGCAACGAAACCGCAAAACACGAACAGTCCGAACC
CTACCGCATTCTCAGCAAAGCCGCCCTGCGCGCCATTGCCGCCAAACAGC
CGGAAGGTTTGGCGGAGCTTGCCGCCGTATACGGCGTAGGCGAAGAAAAA
GCCGCACGTTACGGTGCGGCGGTGTTGGCGGTGTTGGAACGGGATGCCGT
C


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy