Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1404 IGR1406 IGR1401 IGR1405 IGR1403 IGR1407 IGR1402 NG1720 dsbA, - NG1717 NG1724 NG1723 trpC, - NG1721 NG1719 NG1716 mviN, - NG1718 recQ, - NG1722 NG1720 dsbA, - NG1717 NG1724 NG1723 trpC, - NG1721 NG1719 NG1716 mviN, - NG1718 recQ, - NG1722 NG1720 dsbA, - NG1717 NG1724 NG1723 trpC, - NG1721 NG1719 NG1716 mviN, - NG1718 recQ, - NG1722
* Calculated from Protein Sequence

Gene ID: NG1721

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trpC  

Definition:
indole-3-glycerol phosphate synthetase

Gene Start:
1681216

Gene Stop:
1681995

Gene Length:
780

Molecular Weight*:
28607

pI*:
5.50

Net Charge*:
-4.87

EC:
4.1.1.48  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Clements LD, Streips UN, Miller BS.
Differential proteomic analysis of Bacillus subtilis nitrate respiration and fermentation in defined medium.
Proteomics. 2002 Dec;2(12):1724-34.
PMID: 12469342

Comment:
Oklahoma ID: NGO.1721

For other trp genes, see NG0248 (trpA), NG0274 (trpB), NG0872 (trpE), NG1203 (trpD), NG1204 (trpG), NG0261 (trpF).

Blast Summary:  PSI-Blast Search
Residues 1-260 in NG1721 have 97% similarity to residues 1-260 in AE002384, N. meningitidis MC58 indole-3-glycerol phosphate synthase.
Residues 4-260 in NG1721 have 55% similarity to residues 6-264 in
AE004500, P. aeruginosa indole-3-glycerol-phosphate synthase.
Residues 4-260 in NG1721 have 53% similarity to residues 6-264 in M33799, P. putida indoleglycerol phosphate synthetase.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0134
COG name: Indole-3-glycerol phosphate synthase
Functional Class:  E
The phylogenetic pattern of COG0134 is amt-yqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001468 (Indole-3-glycerol phosphate synthase) with a combined E-value of 9.5e-61.
    IPB001468A    57-68
    IPB001468B    91-102
    IPB001468C    117-148
    IPB001468D    187-200
    IPB001468E    236-249


ProDom Summary:  Protein Domain Search
Residues 39-259 are 56% similar to a (PHOSPHATE SYNTHASE INDOLE-3-GLYCEROL IGPS) protein domain (PD001511) which is seen in TRPC_PSEAE.



Paralogs:  Local Blast Search


NG1721 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 259 (E-value = 1.8e-125) place NG1721 in the IGPS family which is described as Indole-3-glycerol phosphate synthase (PF00218)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
99  
224

PDB Hit:
pdb|1PII|1PII N-(5'PHOSPHORIBOSYL)ANTHRANILATE ISOMERASE 158.0 1e-39
pdb|1JCM|1JCM-P TRPC STABILITY MUTANT CONTAINING AN ENGINEERED 155.0 1e-38
pdb|1J5T|1J5T-A CRYSTAL STRUCTURE OF INDOLE-3-GLYCEROL PHOSPHATE136.0 6e-33
pdb|1I4N|1I4N-A CRYS

Gene Protein Sequence:
MTDILNKILATKAQEVAAQKAAVNAEHIRALAAEAAPVRSFIDSIRGKHR
LNLPAVIAEIKKASPSKGLIRPDFRPAEIARAYENAGAACLSVLTDEPYF
QGSPEYLKQAREAVLLPVLRKDFIIDEYQVYQARAWGADAVLLIAAALEQ
GQLERFEALAHELGMTVLLELHDETELEKCRNLTTPLWGVNNRNLRTFEV
SLDQTLSLLPALEGKTVVTESGITGKADVEFMRARGVHTFLIGETFMRAD
DIGAEVGKLF

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGACATCCTCAATAAAATCCTTGCCACCAAGGCACAGGAAGTTGC
CGCCCAAAAAGCCGCCGTCAACGCCGAACACATCCGCGCACTTGCCGCAG
AAGCCGCGCCCGTCCGCAGCTTCATCGATTCGATACGCGGCAAACACCGC
CTAAACCTGCCCGCCGTCATTGCCGAAATCAAAAAGGCAAGCCCGAGCAA
AGGGTTAATCCGCCCCGACTTCCGCCCTGCCGAGATTGCCCGCGCCTATG
AAAACGCCGGGGCGGCGTGTTTGTCGGTACTGACCGACGAACCCTATTTC
CAAGGTTCGCCCGAATACCTCAAACAGGCGCGCGAAGCCGTATTGCTGCC
CGTGCTGCGCAAAGACTTCATCATCGACGAATACCAGGTTTATCAGGCGC
GCGCATGGGGGGCGGATGCCGTCCTGCTGATTGCCGCCGCACTGGAACAG
GGACAATTGGAACGCTTTGAGGCGCTGGCGCACGAATTGGGCATGACCGT
CCTGCTCGAGCTGCACGACGAAACCGAATTGGAAAAATGCCGCAACCTGA
CCACGCCGTTGTGGGGCGTAAACAACCGCAACCTGCGGACTTTTGAAGTC
TCCCTCGACCAAACCCTGTCGCTGCTGCCCGCGCTGGAAGGCAAAACCGT
CGTTACCGAAAGCGGCATTACAGGCAAGGCGGATGTGGAATTTATGCGGG
CGCGCGGCGTGCATACCTTCCTGATCGGCGAAACGTTTATGCGTGCCGAC
GATATTGGGGCGGAAGTGGGCAAACTCTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy