Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1401 IGR1400 IGR1396 IGR1399 IGR1397 IGR1402 IGR1398 NG1712 dsbA, - NG1717 surA, - NG1714 purB, - NG1711 ostA, - NG1715 NG1716 rnb, - NG1713 NG1712 dsbA, - NG1717 surA, - NG1714 purB, - NG1711 ostA, - NG1715 NG1716 rnb, - NG1713 NG1712 dsbA, - NG1717 surA, - NG1714 purB, - NG1711 ostA, - NG1715 NG1716 rnb, - NG1713
* Calculated from Protein Sequence

Gene ID: NG1714

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
surA  

Definition:
peptidyl-prolyl cis-trans isomerase / SurA

Gene Start:
1673755

Gene Stop:
1672757

Gene Length:
999

Molecular Weight*:
35923

pI*:
10.00

Net Charge*:
5.22

EC:
5.2.1.8  

Functional Class:
Cellular processes; Chaperones  

Pathway: pathway table

Secondary Evidence:
Rahfeld,J.U., Schierhorn,A., Mann,K. and Fischer,G.
A novel peptidyl-prolyl cis/trans isomerase from Escherichia coli
FEBS Lett. 343 (1), 65-69 (1994)
Medline: 94215709

chiene-Fischer C, Habazettl J, Tradler T, Fischer G.Evaluation of similarities in the cis/trans isomerase function of trigger factor and DnaK.
Biol Chem. 2002 Dec;383(12):1865-73.
PMID: 12553723


Comment:
Oklahoma ID: NGO.1714c

Blast Summary:  PSI-Blast Search
Residues 1-333 are 88% similar to peptidyl-prolyl cis-trans isomerase in Neisseria meningitidis group B strain MD58 (7225507|).

Numerous hits in gapped BLAST to peptidyl-prolyl cis-trans isomerase / survival protein SurA sequences, e.g.residues 154-329 are 36% similar to peptidyl-prolyl cis-trans isomerase D in Pseudomonas aeruginosa strain PAO1 (9947788|).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0760
COG name: Parvulin-like peptidyl-prolyl isomerase
Functional Class:  O
The phylogenetic pattern of COG0760 is ----yQVcEB-HUJ--ol--X
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB000297 (PpiC-type peptidyl-prolyl cis-trans isomerase) with a combined E-value of 5.8e-11.
    IPB000297A    226-237
    IPB000297B    241-251


ProDom Summary:  Protein Domain Search
Residues 196-286 are 45% similar to a (ISOMERASE ROTAMASE PROTEIN PEPTIDYL-PROLYL PRECURSOR) protein domain (PD002510) which is seen in PRSA_BACSU.



Paralogs:  Local Blast Search


NG1714 is paralogously related to NG1286 (translation initiation factor IF-2) (6e-05) and NG1655 (Neisseria-specific protein, uncharacterized) (1e-04).


Pfam Summary:  Pfam Search
Residues 198 to 289 (E-value = 6.1e-36) place NG1714 in the Rotamase family which is described as PPIC-type PPIASE domain (PF00639)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
21
cleavable N-terminal sequence  
1  
21
non-globular  
22  
189

PDB Hit:
pdb|1M5Y|1M5Y-A CRYSTALLOGRAPHIC STRUCTURE OF SURA, A MOLECULAR 101.0 2e-22
pdb|1FJD|1FJD-A HUMAN PARVULIN-LIKE PEPTIDYL PROLYL CIS/TRANS 57.0 5e-09
pdb|1EQ3|1EQ3-A NMR STRUCTURE OF HUMAN PARVULIN HPAR14 57.0 5e-09
pdb|1J6Y|1J6Y-A SOLU

Gene Protein Sequence:
MMKIKALMIAAALLAAADVHAAPQKAKTAPAKAVKAAATAQKEAAPAQQQ
GGIRFSDGIAVVADNEVITNRRLAEAVAEAKATLPEDAQISESELSRQVL
MQLVNQSLIVQAGKRRNIQASEAEIDAVVAQNPALKNLSPTQRRELADNI
IAEKVRQQAVMQNSRVSEAEIDAFLEQAQKQGITLPEGAPLRQYRAQHIL
IKADSKNAAVGAESTIRKIYDQARNGTDFAGLARRYSQDASAGNGGDLGW
FADGVMVPAFEEAVHALKPGQVGAPVRTQFGWHIIKLNEVRDAGTPEERI
RNSVRQYIFQQKAGQATVNLLRDLHSGAYVDIR

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAAAATCAAAGCCCTGATGATTGCCGCCGCATTGCTGGCAGCAGC
CGATGTCCACGCCGCACCGCAAAAGGCAAAAACCGCGCCCGCCAAAGCGG
TCAAAGCTGCCGCCACGGCGCAAAAAGAAGCCGCACCCGCACAACAGCAG
GGCGGTATCCGCTTTTCAGACGGCATTGCCGTCGTTGCCGACAACGAAGT
CATCACCAACCGCCGGCTTGCCGAAGCCGTTGCCGAAGCCAAAGCCACCC
TGCCCGAAGACGCGCAGATAAGTGAATCCGAGCTGTCCCGACAGGTGCTG
ATGCAGCTTGTCAACCAATCCCTGATTGTACAGGCGGGCAAACGCCGCAA
CATTCAGGCAAGTGAAGCGGAAATCGATGCCGTCGTCGCACAAAATCCCG
CCCTCAAAAACCTCAGCCCCACCCAACGCCGCGAGCTTGCCGACAACATC
ATTGCCGAAAAAGTCCGCCAGCAGGCAGTGATGCAAAACAGCCGCGTGAG
CGAAGCTGAAATTGATGCCTTCCTCGAGCAGGCGCAAAAACAAGGCATCA
CCCTGCCCGAAGGCGCACCGTTGCGCCAATACCGCGCCCAACACATCCTG
ATTAAAGCCGACAGCAAAAACGCCGCCGTCGGCGCGGAAAGTACCATCCG
CAAAATCTACGACCAGGCGCGCAACGGCACGGATTTCGCAGGTTTGGCAC
GCCGATATTCCCAAGACGCAAGCGCGGGCAATGGCGGCGACTTGGGCTGG
TTTGCCGACGGCGTAATGGTTCCCGCCTTTGAAGAAGCCGTCCACGCGCT
CAAACCCGGACAGGTCGGCGCGCCTGTCCGCACCCAATTCGGCTGGCACA
TCATCAAATTGAACGAAGTGCGCGATGCCGGCACGCCGGAGGAACGTATC
CGCAATTCCGTGCGGCAATACATCTTCCAACAAAAAGCCGGACAGGCAAC
CGTCAACCTGTTGCGCGACCTGCATTCCGGCGCGTATGTCGACATCCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy