Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1400 IGR1396 IGR1395 IGR1399 IGR1397 IGR1398 NG1712 surA, - NG1714 purB, - NG1711 NG1710 ostA, - NG1715 rnb, - NG1713 NG1712 surA, - NG1714 purB, - NG1711 NG1710 ostA, - NG1715 rnb, - NG1713 NG1712 surA, - NG1714 purB, - NG1711 NG1710 ostA, - NG1715 rnb, - NG1713
* Calculated from Protein Sequence

Gene ID: NG1713

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rnb  

Definition:
exoribonuclease II (rnb)

Gene Start:
1670367

Gene Stop:
1672271

Gene Length:
1905

Molecular Weight*:
70340

pI*:
4.80

Net Charge*:
-23.61

EC:
3.1.13.1  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table

Secondary Evidence:
Zilhao,R., Camelo,L. and Arraiano,C.M.
DNA sequencing and expression of the gene rnb encoding Escherichia
coli ribonuclease II
Mol. Microbiol. 8 (1), 43-51 (1993)
Medline: 93268098


Comment:
Exoribonuclease II (rnb) is predicted to be involved in mRNA degradation.It hydrolyzes single-stranded polyribonucleotides in the 3' to 5' direction.


Oklahoma ID: NGO.1713

Blast Summary:  PSI-Blast Search
Residues 10-635 are 94% similar to a ribonuclease II-related protein in Neisseria meningitidis MC58 (7413424|).

Numerous hits in gapped BLAST to ribonuclease II family protein sequences,e.g.residues 233-515 are 23% similar to exoribonuclease II in Escherichia coli (7449111|).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0557
COG name: Exoribonucleases
Functional Class:  K
The phylogenetic pattern of COG0557 is ----YqvCEb-Hujgp-lin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001900 (Ribonuclease II domain) with a combined E-value of 9.6e-34.
    IPB001900A    252-264
    IPB001900B    277-316
    IPB001900C    442-451
    IPB001900D    492-511


ProDom Summary:  Protein Domain Search
Residues 238-321 are 35% similar to a (PROTEIN HYDROLASE NUCLEASE VACB HOMOLOG RIBONUCLEASE II) protein domain (PD003098) which is seen in P73177_SYNY3.



Paralogs:  Local Blast Search


NG1713 is paralogously related to NG0801 (ribonuclease R (exoribonuclease RNase R) (VacB protein)) (2e-05).


Pfam Summary:  Pfam Search
Residues 140 to 536 (E-value = 8.4e-08) place NG1713 in the RNB family which is described as RNB-like protein (PF00773)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
52  
182
non-globular  
499  
573

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
LSFHRKIRKMNIFYEESGQFKVAVVVQKNDATYQVDTQHGKRTKVKANNV
FAEFDGDMAAFLENAQAQAADIDTDLLWEVCGEEEFTAEAIAEEYYGHAP
TKTELAATLIALYAAPVYFYKKAKGVFKAAPEETLKQALAAIERKKQQDA
QIDAWAEALKRGEMPSEIAADLRTILHAPDKQSLTYKAFTKAADALKTSA
YELAKKTGGITSIPQYLQDGFEIKYFPKGTGFPDLSLPEMPDLPKADVTA
FSIDDESTTEVDDALSLTDLGNGTKRVGIHIAAPSLAVRQGGGMEQIIMQ
RLSTVYFPGGKITMLPENWITAFSLDAGAYRPAVSIYFDVDGEFNVGEPT
CKIEAVNIAANLRIQAIEPHFNAETGLDQAGEMMFAHHQDLIWFYQFATA
LQKARGKYEPDRAPQYDYSIELDEEGNVSVVRRERGSPIDTLVSEMMILA
NSTWAQMLDENGLPGLFRVQPAGKVRMSTQSEPHIGMGVQHYGWFTSPLR
RAADYINQKQLLSLIDDTAEPLFQQSDAELFAALRDFDTAYAAYADFQRQ
MEAYWSLVYLQQQGISELTATILKEDLVRIEGLPLTTRATGIPFDALPKS
QALFKITELDAEKQFVSLNYIKAAAPGGKTAGNAV

Gene Nucleotide Sequence:  Sequence Viewer
TTGAGTTTCCACAGAAAAATCCGAAAAATGAATATTTTTTACGAAGAGTC
CGGCCAGTTCAAAGTTGCCGTCGTCGTCCAAAAAAACGACGCTACCTACC
AAGTCGATACCCAACACGGCAAACGCACCAAAGTGAAGGCAAACAATGTC
TTTGCCGAGTTTGACGGCGATATGGCGGCGTTTTTGGAAAACGCTCAGGC
GCAGGCGGCGGACATCGACACCGATTTATTGTGGGAAGTATGCGGCGAAG
AGGAGTTTACCGCCGAAGCCATCGCCGAAGAATATTACGGCCATGCGCCG
ACCAAAACCGAGCTGGCGGCGACTTTGATTGCGCTGTACGCCGCGCCGGT
GTATTTCTACAAAAAAGCCAAAGGCGTGTTCAAAGCCGCGCCCGAAGAAA
CTTTGAAACAAGCGCTTGCCGCCATCGAACGCAAAAAACAGCAAGACGCG
CAAATCGACGCTTGGGCGGAAGCCTTGAAACGCGGCGAGATGCCGTCTGA
AATCGCGGCGGATTTGAGAACCATCTTACACGCGCCCGACAAACAGTCGC
TGACCTACAAAGCCTTTACCAAAGCCGCCGACGCACTGAAAACCTCCGCC
TACGAACTGGCGAAAAAAACGGGCGGCATTACGTCCATTCCGCAATACCT
GCAAGACGGCTTTGAAATCAAATACTTCCCCAAAGGAACAGGTTTCCCCG
ACCTCTCCCTTCCCGAAATGCCCGACCTGCCCAAGGCCGACGTTACCGCC
TTTTCCATTGACGACGAATCGACCACCGAAGTGGACGATGCCTTGAGCCT
GACCGATTTGGGCAACGGCACGAAGCGCGTCGGCATCCACATCGCCGCGC
CGTCGCTTGCCGTCCGACAAGGCGGCGGAATGGAACAAATCATTATGCAG
CGGTTGAGTACGGTTTATTTCCCCGGCGGCAAAATCACGATGCTGCCCGA
AAACTGGATTACCGCGTTCAGCCTCGATGCAGGCGCATACCGCCCTGCCG
TCAGCATTTATTTCGATGTGGACGGCGAGTTCAACGTCGGCGAGCCGACC
TGCAAAATCGAAGCCGTCAACATCGCCGCAAACCTGCGTATCCAAGCCAT
CGAGCCGCATTTCAACGCAGAAACCGGCTTGGACCAAGCAGGCGAAATGA
TGTTCGCCCACCATCAAGACCTGATTTGGTTCTATCAATTCGCCACCGCC
CTGCAAAAAGCGCGCGGCAAATACGAACCCGACCGCGCGCCGCAATACGA
TTACAGCATCGAATTGGATGAAGAAGGCAACGTCTCCGTCGTCCGCCGCG
AACGCGGTTCGCCCATCGATACGCTGGTCAGCGAGATGATGATTCTTGCC
AACAGCACTTGGGCGCAAATGCTAGACGAAAACGGGCTGCCCGGCCTTTT
CCGCGTCCAACCGGCAGGCAAAGTGCGCATGAGCACCCAATCCGAGCCGC
ACATCGGCATGGGCGTGCAGCATTACGGCTGGTTTACCTCGCCGCTGCGC
CGCGCCGCCGACTACATCAACCAAAAACAACTCCTCAGCCTGATAGACGA
CACCGCCGAGCCGCTCTTCCAGCAAAGCGATGCCGAACTCTTCGCCGCCC
TGCGCGATTTCGACACCGCCTACGCCGCCTACGCCGACTTCCAACGGCAG
ATGGAAGCCTACTGGAGCCTCGTGTACCTGCAACAACAAGGCATCAGCGA
ACTGACCGCGACGATTCTGAAAGAAGACCTCGTCCGCATCGAAGGTCTGC
CACTGACAACGCGCGCGACCGGTATTCCGTTTGACGCGCTGCCCAAATCG
CAGGCATTGTTTAAAATCACCGAATTGGATGCCGAGAAGCAGTTTGTCTC
GCTCAACTACATCAAGGCAGCCGCACCCGGGGGCAAAACGGCAGGCAATG
CCGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy