Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1393 IGR1396 IGR1395 IGR1399 IGR1397 IGR1394 IGR1398 NG1712 surA, - NG1714 purB, - NG1711 NG1710 NG1709 rnb, - NG1713 dinG, - NG1708 NG1712 surA, - NG1714 purB, - NG1711 NG1710 NG1709 rnb, - NG1713 dinG, - NG1708 NG1712 surA, - NG1714 purB, - NG1711 NG1710 NG1709 rnb, - NG1713 dinG, - NG1708
* Calculated from Protein Sequence

Gene ID: NG1711

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
purB  

Definition:
putative adenylosuccinate lyase (PurB)

Gene Start:
1669534

Gene Stop:
1668167

Gene Length:
1368

Molecular Weight*:
50326

pI*:
5.90

Net Charge*:
-6.64

EC:
4.3.2.2  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Alanine and aspartate metabolism
Purine metabolism

Secondary Evidence:
He,B., Smith,J.M. and Zalkin,H.
Escherichia coli purB gene: cloning, nucleotide sequence, and
regulation by purR
J. Bacteriol. 174 (1), 130-136 (1992)
Medline: 92104952


Comment:
Oklahoma ID: NGO.1711c

For other 'pur' genes, see NG0333 (purC), NG0398 (purA), NG0526 (purM), NG0748 (purE), NG0875 (purK), NG1183 (purL), NG1224 (purN), NG1466 (purH), NG0263 (purF), NG1939 (purD)

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST; e.g. residues 2-456 are 66% similar to gb|AAG06017.1|AE004691_8 (AE004691) adenylosuccinate lyase of Pseudomonas aeruginosa.

Residues 1-456 are 97% similar to emb|CAB85414.1| (AL162758) adenylosuccinate lyase of Neisseria meningitidis Z2491.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0015
COG name: Adenylosuccinate lyase
Functional Class:  F
The phylogenetic pattern of COG0015 is amtkyqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000362 (Fumarate lyase) with a combined E-value of 8.1e-15.
    IPB000362A    167-180
    IPB000362B    294-304


ProDom Summary:  Protein Domain Search
Residues 165-456 are 63% similar to a (LYASE BIOSYNTHESIS ARGININOSUCCINATE FUMARATE HYDRATASE) protein domain (PD000660) which is seen in PUR8_HAEIN.

Residues 2-64 are 55% similar to a (LYASE ADENYLOSUCCINATE ADENYLOSUCCINASE ASL PURINE) protein domain (PD024323) which is seen in PUR8_HAEIN.

Residues 67-164 are 60% similar to a (LYASE ADENYLOSUCCINATE ADENYLOSUCCINASE) protein domain (PD002788) which is seen in PUR8_ECOLI.

Residues 165-243 are 59% similar to a (ADENYLOSUCCINATE LYASE - LIKE) protein domain (PD128429) which is seen in O49514_ARATH.



Paralogs:  Local Blast Search


NG1711 is paralogously related to NG1029 (fumarate hydratase (fumarase C)) (2e-04).


Pfam Summary:  Pfam Search
Residues 13 to 321 (E-value = 3.1e-66) place NG1711 in the Lyase_1 family which is described as Lyase (PF00206)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
116
non-globular  
396  
456

PDB Hit:
pdb|1F1O|1F1O-A STRUCTURAL STUDIES OF ADENYLOSUCCINATE LYASES 94.4 4e-20
pdb|1C3U|1C3U-A T. MARITIMA ADENYLOSUCCINATE LYASE 92.1 2e-19
pdb|1C3C|1C3C-A T. MARITIMA ADENYLOSUCCINATE LYASE 92.1 2e-19
pdb|1DOF|1DOF-A THE

Gene Protein Sequence:
MINPIASLSPLDGRYAQSVEALRPIFSEYGLMKARVKVELNWLKALAAEP
EIAEVPPFSAETLAEIDKVIENFSLEDAAAVKAIEATTNHDVKAIEYWLK
KRFAEVPEVAAVSEFIHFACTSEDINNLSHALMLQEARETVILPKLAEII
GKLTAMAHDLAAVPMMSRTHGQPATPTTLGKETANVVYRLQRQFKILQAQ
EFLGKINGAVGNYNAHMAAYPDVDWETHCRNFVEISLGLTFNPYTIQIEP
HDYMAEFFQTLSRINTILIDFSRDVWGYISLGYFKQKVKAGEVGSSTMPH
KVNPIDFENSEGNLGMANAVLGFLAEKLPVSRWQRDLTDSTVLRNMGVGV
GYAVLGFAAHLRGLNKLEPNPAALAADLDVTWELLAEPIQTVMRRYGVAN
PYEKLKDLTRGKGGITPEVLKGFIGSLEIPAEAKAKLLELTPALYVGKAE
ALAKRI

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCAACCCCATCGCCTCGCTTTCCCCCCTAGACGGCCGTTATGCCCA
ATCCGTTGAAGCATTGCGCCCGATTTTTTCAGAGTACGGACTGATGAAGG
CGCGCGTCAAAGTCGAATTAAACTGGCTCAAAGCCCTGGCCGCCGAGCCG
GAGATTGCCGAAGTGCCGCCCTTCAGTGCCGAAACGCTTGCCGAAATCGA
CAAAGTCATCGAAAACTTTTCATTAGAAGACGCGGCCGCCGTCAAAGCCA
TCGAAGCCACGACCAATCATGATGTCAAAGCCATCGAATATTGGCTGAAA
AAACGTTTTGCCGAAGTGCCGGAAGTCGCCGCCGTGAGCGAGTTCATCCA
CTTCGCCTGCACCAGCGAAGACATCAACAACCTGTCCCACGCCCTGATGC
TGCAAGAGGCGCGCGAAACCGTCATCCTGCCCAAACTTGCCGAAATCATC
GGCAAACTCACCGCTATGGCGCACGACCTTGCCGCCGTCCCGATGATGAG
CCGCACCCACGGCCAGCCCGCCACACCGACCACTTTGGGCAAAGAAACCG
CCAATGTCGTGTACCGCCTGCAACGCCAGTTCAAAATCCTTCAGGCGCAA
GAATTCCTCGGCAAAATCAACGGCGCGGTCGGCAACTACAACGCCCACAT
GGCCGCCTATCCCGATGTGGATTGGGAAACACACTGCCGCAACTTCGTCG
AAATCAGCCTCGGTCTGACCTTCAACCCCTACACCATCCAAATCGAGCCG
CACGACTATATGGCGGAGTTTTTCCAAACCCTCAGCCGCATCAACACGAT
TCTCATCGACTTCAGCCGCGACGTTTGGGGTTATATTTCATTGGGTTATT
TCAAACAAAAAGTCAAAGCGGGCGAAGTCGGCTCTTCCACCATGCCGCAC
AAAGTCAACCCCATCGACTTTGAAAACTCCGAGGGCAACCTCGGCATGGC
AAACGCCGTATTGGGCTTTTTGGCGGAAAAACTGCCCGTCTCACGCTGGC
AGCGCGATTTGACCGACAGCACCGTATTGCGCAATATGGGCGTGGGCGTG
GGCTATGCCGTGTTGGGTTTCGCCGCCCACTTGCGCGGTCTGAACAAGCT
CGAGCCGAACCCTGCCGCGCTTGCCGCCGATTTGGATGTCACTTGGGAGC
TGCTCGCCGAGCCGATTCAAACCGTAATGCGCCGTTACGGTGTCGCCAAT
CCTTACGAAAAACTGAAAGACCTGACGCGCGGTAAAGGCGGCATCACACC
CGAAGTGCTGAAAGGCTTTATCGGATCGCTGGAAATTCCCGCCGAAGCCA
AAGCCAAATTGCTTGAGCTGACCCCCGCGCTGTATGTGGGCAAGGCTGAA
GCGTTGGCGAAACGGATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy