Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1391 IGR1393 IGR1390 IGR1388 IGR1389 IGR1394 IGR1392 IGR1387 NG1704 NG1705 NG1702 NG1710 NG1701 NG1709 pivNG, - NG1703 phrB, - NG1707 ffh, - NG1700 dinG, - NG1708 NG1704 NG1705 NG1702 NG1710 NG1701 NG1709 pivNG, - NG1703 phrB, - NG1707 ffh, - NG1700 dinG, - NG1708 Type: inverse, Name:  - 154 Type: direct, Name:  - 126 Type: inverse, Name:  - 174 Type: inverse, Name:  - 143 Type: inverse, Name:  - 166 Type: inverse, Name:  - 160 Type: inverse, Name:  - 178 Type: inverse, Name:  - 183 NG1705 NG1702 NG1710 NG1704 NG1701 NG1709 pivNG, - NG1703 phrB, - NG1707 ffh, - NG1700 dinG, - NG1708 lysR, - NG1706 lysR, - NG1706
* Calculated from Protein Sequence

Gene ID: NG1707

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
phrB  

Definition:
deoxyribodopyrimidine photolyase (PhrB)

Gene Start:
1661801

Gene Stop:
1663096

Gene Length:
1296

Molecular Weight*:
48211

pI*:
7.80

Net Charge*:
4.34

EC:
4.1.99.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Park,H.W., Kim,S.T., Sancar,A. and Deisenhofer,J.
Crystal structure of DNA photolyase from Escherichia coli
Science. 268 (5219), 1866-1872 (1995)
Medline: 95327928

Li,Y.F. and Sancar,A.
Active site of Escherichia coli DNA photolyase: mutations at Trp277 alter the selectivity of the enzyme without affecting the quantum yield of photorepair
Biochemistry. 29 (24), 5698-5706 (1990)
Medline: 90344791

Sancar,G.B. and Sancar,A.
Structure and function of DNA photolyases
Trends Biochem. Sci. 12, 259-261 (1987)

Sancar,G.B., Smith,F.W., Lorence,M.C., Rupert,C.S. and Sancar,A.
Sequences of the Escherichia coli photolyase gene and protein
The Journal of biological chemistry. 259 (9), 6033-6038 (1984)
Medline: 84185763


Comment:
Oklahoma ID: NGO.1707

Blast Summary:  PSI-Blast Search
Residues 1-432 are 94% similar to deoxyribodipyrimidine photo-lyase in Neisseria meningitidis group A strain Z2491 (7380817).

Numerous hits in gapped BLAST to deoxyribodipyrimidine photo-lyase sequences,e.g.residues 19-412 are 30% similar to deoxyribodipyrimidine photolyase in Pseudomonas aeruginosa strain PAO1 (9950915|).Residues 19-416 are 29% similar to deoxyribodipyrimidine photo-lyase in Escherichia coli (130152|).

COGS Summary:  COGS Search
BeTs to 4 clades of COG0415
COG name: Deoxypyrimidine photolyase
Functional Class:  L
The phylogenetic pattern of COG0415 is --t-y--Ce------------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002081 (DNA photolyases class 1) with a combined E-value of 1.3e-26.
    IPB002081A    21-31
    IPB002081C    224-252
    IPB002081D    292-341
    IPB002081E    360-401
***** PR00147 (DNA photolyase signature) with a combined E-value of 6.2e-09.
    PR00147B    307-323
    PR00147D    366-380


ProDom Summary:  Protein Domain Search
Residues 292-401 are 42% similar to a (PHOTOLYASE DNA LYASE CHROMOPHORE) protein domain (PD004390) which is seen in PHR_ECOLI.

Residues 19-251 are 24% similar to a (PHOTOLYASE LYASE DNA CHROMOPHORE) protein domain (PD002476) which is seen in PHR_ECOLI.



Paralogs:  Local Blast Search


NG1707 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 17 to 181 (E-value = 2.7e-06) place NG1707 in the DNA_photolyase family which is described as DNA photolyase (PF00875)
Residues 205 to 432 (E-value = 6.3e-26) place NG1707 in the FAD_binding_7 family which is described as FAD binding domain of DNA photolyase (PF03441)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
119
transmembrane  
33  
49

PDB Hit:
pdb|1DNP|1DNP-A STRUCTURE OF DEOXYRIBODIPYRIMIDINE PHOTOLYASE 141.0 2e-34
pdb|1QNF|1QNF STRUCTURE OF PHOTOLYASE 116.0 7e-27
pdb|1NP7|1NP7-A CRYSTAL STRUCTURE ANALYSIS OF SYNECHOCYSTIS SP. 109.0 7e-25
pdb|1IQR|1IQR-A CRYS

Gene Protein Sequence:
MPSETALPLYADTRAAHTLVWFRQNLRIRDNAALCAAVAEGSPVIGIWID
DAETDNPRRAAFYRQSAAELAQGLARRGIPLYTAASPAGLVRLAVRLNIR
AVIADESHTFADKLADNALWHELDKHGIALTFVNDRSVFGKTDLTPDNGT
AHTDFNRYREVWLDRFSKQPPAGSDLFAAYRQPFPENLPAPPPAALSDGI
FLPQNGGETAAWRQWRRFLEQAASYSVLKDFPSRKNTSLMGAYLSVGCIS
PRLLARESLERRLNAWADNIIRRDFFLQLALQHADDDPSDGNPEHTLRLT
LWQQGRTGIPIIDAAMRCLHKTGSLHPALRRLSADFFCHVLNLPRREGEI
WFARQLTDFDAAINQGNWRLAASRHTCPDIAAASYRTDPDGTFIKRHIPE
LAHLSADTVHTPWRFACSVDTHGYPARPVAGV

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGTCTGAAACCGCCCTCCCCCTTTATGCGGACACGCGCGCCGCGCA
CACGCTCGTCTGGTTCCGCCAAAACCTCCGCATCCGCGACAACGCCGCCT
TATGCGCCGCCGTTGCCGAAGGTTCGCCCGTTATCGGCATTTGGATTGAC
GATGCCGAAACAGACAACCCGCGCCGCGCCGCGTTCTACCGCCAATCCGC
CGCCGAACTCGCCCAAGGGCTGGCAAGGCGCGGCATCCCGCTCTACACGG
CGGCATCGCCTGCCGGGCTTGTCCGGCTCGCCGTCCGCCTCAATATCCGC
GCCGTCATCGCCGACGAATCCCATACTTTTGCCGACAAACTCGCCGACAA
CGCCCTTTGGCACGAATTGGACAAACACGGCATCGCGTTAACCTTCGTCA
ACGACCGTTCCGTTTTCGGCAAAACCGACCTGACACCAGACAACGGTACG
GCACACACCGATTTCAACCGCTACCGCGAAGTATGGCTCGACCGCTTTTC
CAAGCAGCCCCCCGCCGGTTCGGACCTATTCGCGGCATACCGCCAACCCT
TCCCCGAAAACCTGCCCGCCCCGCCGCCTGCCGCGCTTTCAGACGGCATC
TTCCTGCCGCAAAACGGCGGCGAAACGGCGGCTTGGCGGCAGTGGCGGCG
GTTTCTCGAACAGGCGGCTTCCTACTCCGTTTTAAAGGATTTCCCTTCGC
GCAAAAACACTTCGCTGATGGGCGCGTATTTGAGTGTCGGCTGCATCTCG
CCGCGCCTGCTCGCGCGGGAAAGCCTCGAACGCCGTCTGAACGCGTGGGC
GGACAACATCATCCGCCGCGATTTTTTCCTTCAACTTGCCTTGCAGCACG
CGGATGACGACCCTTCAGACGGCAATCCGGAACACACCCTGCGCCTGACG
CTTTGGCAGCAGGGCCGGACCGGCATTCCGATTATCGATGCCGCGATGCG
CTGTTTGCACAAAACCGGCAGCCTCCACCCCGCCCTGAGACGCTTGAGCG
CGGATTTTTTCTGCCACGTTTTAAACCTCCCCCGCCGCGAAGGCGAGATA
TGGTTTGCCCGGCAGCTGACCGATTTCGATGCGGCAATCAACCAAGGCAA
CTGGCGGCTTGCCGCCTCACGGCACACCTGCCCCGACATTGCCGCCGCCT
CATACCGTACCGACCCGGACGGTACTTTTATCAAACGGCACATTCCCGAA
CTCGCCCACCTGTCCGCCGACACCGTCCACACGCCTTGGCGGTTTGCCTG
TTCGGTCGATACCCACGGCTATCCCGCCCGCCCCGTCGCCGGCGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy