Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap rRNA-5S-3 rRNA-23S-3 IGR1381 IGR1382 IGR1380 IGR1383 IGR1379 IGR1379.1 IGR1384 IGR1385 IGR1379.2 IGR1384.1 IGR1385.1 NG1697 NG1690 vapA, - NG1689 NG1689.1 comE, - NG1698 folA, - NG1694 aroG, - NG1695 NG1688 NG1696 NG1692 NG1693 NG1697 NG1690 vapA, - NG1689 NG1689.1 comE, - NG1698 folA, - NG1694 aroG, - NG1695 NG1688 NG1696 NG1692 NG1693 Type: direct, Name:  - 110 Type: direct, Name:  - 101 Type: direct, Name:  - 102 Type: direct, Name:  - 108 Type: direct, Name:  - 124 NG1697 NG1690 NG1689.1 comE, - NG1698 folA, - NG1694 aroG, - NG1695 NG1688 vapA, - NG1689 NG1696 NG1693 NG1691 NG1692 NG1691
* Calculated from Protein Sequence

Gene ID: NG1695

DNA Molecule Name:
1  

Genbank ID:
5051411

Gene Name:
aroG  

Definition:
phospho-2-dehydr-3-deoxyheptonate aldolase (DAHP)

Gene Start:
1647298

Gene Stop:
1646246

Gene Length:
1053

Molecular Weight*:
38643

pI*:
6.80

Net Charge*:
-2.13

EC:
4.1.2.15  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Primary Evidence:
Zhu,P., Morelli,G. and Achtman,M.,
The opcA and (psi)opcB regions in Neisseria: genes, pseudogenes,
deletions, insertion elements and DNA islands,
Mol. Microbiol. 33 (3), 635-650 (1999)
Medline: 99348393


Secondary Evidence:
Shumilin,I.A., Kretsinger,R.H. and Bauerle,R.H.
Crystal structure of phenylalanine-regulated 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase from
Escherichia coli
Structure 7, 865-875 (1999)

Davies,W.D. and Davidson,B.E.
The nucleotide sequence of aroG, the gene for
3-deoxy-D-arabinoheptulosonate-7-phosphate synthetase (phe) in
Escherichia coli K12
Nucleic acids research. 10 (13), 4045-4048 (1982)
Medline: 82274236


Comment:
For other 'aro' genes,see NG0092 (aroB), NG0740 (aroD), NG0093
(aroK), NG900(aroA), NG1331 (aroC),NG1602 (aroE).

Oklahoma ID: NGO.1695c

Blast Summary:  PSI-Blast Search
NG1695 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 5051411.

Residues 1-351 in NG1695 have 98% similarity to residues 1-351 in AL162758, N. meningitidis Z2491 phospho-2-dehydr-3-deoxyheptonate aldolase.

Residues 4-342 in NG1695 have 65% similarity to residues 2-344 in AP002553, E. coli O157:H7 3-deoxy-D-arabinoheptulosonate- 7-phosphate synthase.


COGS Summary:  COGS Search
BeTs to 6 clades of COG0722
COG name: DAHP synthase/3-Deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
Functional Class:  E,M
The phylogenetic pattern of COG0722 is ----YqvcEb-Huj----INx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001785 (DAHP synthetase class I) with a combined E-value of 4.4e-202.
    IPB001785A    8-31
    IPB001785B    42-75
    IPB001785C    91-131
    IPB001785D    139-190
    IPB001785E    209-237
    IPB001785F    264-307
    IPB001785G    318-339
    IPB001785B    45-78


ProDom Summary:  Protein Domain Search
Residues 8-329 are 66% similar to a (ALDOLASE) protein domain (PD005060) which is seen in AROG_ECOLI.



Paralogs:  Local Blast Search


NG1695 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 27 to 337 (E-value = 2e-151) place NG1695 in the DAHP_synth_1 family which is described as DAHP synthetase I family (PF00793)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1GG1|1GG1-A CRYSTAL STRUCTURE ANALYSIS OF DAHP SYNTHASE IN 441.0 0e+00
pdb|1HFB|1HFB-A CRYSTAL STRUCTURE OF THE TYROSINE-REGULATED 339.0 5e-94
pdb|1GG1|1GG1-A CRYSTAL STRUCTURE ANALYSIS OF DAHP SYNTHASE IN 575.0 0e+00
pdb|1HFB|1HFB-A CRYS

Gene Protein Sequence:
MTHHYPTDDIKIKEVKELLPPIAHLYELPISKEASGLVHRTRQEISDLVH
GRDRRLLVIIGPCSIHDPKAALEYAERLLKLRKRYENELLIVMRVYFEKP
RTTVGWKGLINDPHLDGTFDINFGLRQARSLLLSLNNMGMPASTEFLDMI
TPQYYADLISWGAIGARTTESQVHRELASGLSCPVGFKNGTDGNLKIAID
AIGAASHSHHFLSVTKAGHSAIVHTGGNPDCHVILRGGKEPNYDAGHVSE
AVEQLRAAGVTDKLMIDCSHANSRKDYTRQMEVAQDIADQLEQDGGNIMG
VMVESHLVEGRQDKPEVYGKSITDACIGWGATEELLALLAGANTKRMARA
G

Gene Nucleotide Sequence:  Sequence Viewer
ATGACACACCATTACCCCACAGACGATATTAAGATTAAAGAAGTTAAAGA
GTTGTTGCCGCCGATTGCCCATCTTTACGAGCTGCCGATTTCCAAAGAGG
CTTCGGGCTTGGTTCACCGCACCCGTCAGGAAATTTCCGATTTGGTTCAC
GGCAGGGACAGGCGGCTGTTGGTCATTATCGGGCCGTGTTCGATTCACGA
TCCGAAAGCGGCGTTGGAATATGCGGAACGTCTGTTGAAACTCCGCAAGC
GGTATGAAAACGAGCTTTTGATCGTGATGCGCGTTTATTTCGAGAAGCCG
AGAACGACGGTGGGTTGGAAAGGTTTGATTAACGACCCGCATTTGGACGG
TACGTTCGACATCAATTTCGGTTTGCGTCAGGCGCGCAGTCTGTTGTTGT
CCCTGAATAATATGGGCATGCCTGCCTCTACCGAATTTTTGGATATGATT
ACACCCCAGTATTATGCCGACCTGATTTCTTGGGGGGCAATCGGCGCGCG
GACGACCGAAAGCCAAGTCCACCGCGAATTGGCAAGCGGTCTGTCCTGCC
CCGTCGGCTTTAAAAACGGTACGGACGGCAATTTGAAGATTGCGATCGAC
GCAATCGGTGCGGCGAGCCATTCGCATCATTTCTTGTCTGTAACCAAGGC
CGGGCATTCCGCCATTGTCCATACCGGCGGCAATCCCGACTGTCATGTCA
TTTTGCGCGGCGGAAAAGAGCCGAATTATGATGCGGGACACGTCAGCGAG
GCGGTGGAACAACTGCGTGCGGCAGGGGTAACCGACAAGCTGATGATCGA
TTGCAGCCACGCCAACAGCCGCAAGGATTACACCCGGCAGATGGAAGTGG
CACAAGACATTGCCGACCAATTGGAACAGGACGGCGGCAATATCATGGGC
GTGATGGTGGAAAGCCATTTGGTCGAAGGCAGGCAGGACAAGCCGGAAGT
GTACGGCAAGAGCATTACCGATGCGTGTATCGGTTGGGGCGCGACTGAAG
AATTGTTGGCATTGTTGGCGGGTGCGAACACAAAACGTATGGCGCGCGCA
GGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy