Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR1374 IGR1367 IGR1369 IGR1372 IGR1373 IGR1376 IGR1371 IGR1368 IGR1370 IGR1375 IGR1366 rpmG, - NG1679 rpmB, - NG1680 NG1674 ispB, - NG1675 farA, - NG1683 farB, - NG1682 pilF, - NG1673 rpmA, - NG1677 rplU, - NG1676 NG1684 NG1685 visC, - NG1678 rpmG, - NG1679 rpmB, - NG1680 NG1674 ispB, - NG1675 farA, - NG1683 farB, - NG1682 pilF, - NG1673 rpmA, - NG1677 rplU, - NG1676 NG1684 NG1685 visC, - NG1678 NG1674 ispB, - NG1675 farA, - NG1683 farB, - NG1682 pilF, - NG1673 NG1681 rpmB, - NG1680 NG1681 rpmG, - NG1679 rplU, - NG1676 NG1685 visC, - NG1678 rpmA, - NG1677 NG1684
* Calculated from Protein Sequence

Gene ID: NG1678

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
visC  

Definition:
monooxygenase (VisC)

Gene Start:
1632071

Gene Stop:
1633252

Gene Length:
1182

Molecular Weight*:
43591

pI*:
8.40

Net Charge*:
5.72

EC:
1.14.13.-  

Functional Class:
Unassigned  

Pathway: pathway table
Alkaloid biosynthesis I
Androgen and estrogen metabolism
Bile acid biosynthesis
Flavonoids, stilbene and lignin biosynthesis
Histidine metabolism
Methane metabolism
Phenylalanine metabolism
Sterol biosynthesis
Styrene degradation
Tetrachloroethene degradation
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Comment:
Oklahoma ID: NGO.1678

Blast Summary:  PSI-Blast Search
Residues 1-394 are 98% similar to a probable monooxygenase in
Neisseria meningitidis group A strain Z2491 (11353984|).

Numerous hits in gapped BLAST to monooxygenase / visC protein sequences, e.g. residues 6-394 are 27% similar to visC protein in Vibrio cholerae group O1 strain N16961 (11255980|).Residues 6-394 are 27% similar to visC protein in Escherichia coli (421190|).

COGS Summary:  COGS Search
BeTs to 6 clades of COG0654
COG name: 2-Octaprenyl-6-metoxyphenol hydroxylase and related FAD-dependent oxidoreductases
Functional Class:  H,C
The phylogenetic pattern of COG0654 is ----Y--cEBR---------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000689 (UbiH/COQ6 monooxygenase family) with a combined E-value of 4.2e-29.
    IPB000689A    6-18
    IPB000689B    162-196
    IPB000689C    206-230
    IPB000689D    288-338
***** PR00420 (Aromatic-ring hydroxylase (flavoprotein monooxygenase) signature) with a combined E-value of 1.4e-12.
    PR00420A    6-28
    PR00420B    160-175
    PR00420C    284-299
    PR00420D    299-315
***** IPB000171 (Bacterial-type phytoene dehydrogenase) with a combined E-value of 3.8e-10.
    IPB000171A    8-38


ProDom Summary:  Protein Domain Search
Residues 6-175 are 22% similar to a (HYPOTHETICAL 34.3 KD PROTEIN) protein domain (PD210785) which is seen in Q9ZCZ0_RICPR.

Residues 179-394 are 27% similar to a (MONOOXYGENASE OXIDOREDUCTASE HYDROXYLASE FAD PROTEIN) protein domain (PD000900) which is seen in YD00_SYNY3.

Residues 6-175 are 28% similar to a (OXIDOREDUCTASE MONOOXYGENASE FLAVOPROTEIN) protein domain (PD009774) which is seen in VISC_ECOLI.



Paralogs:  Local Blast Search


NG1678 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 160 to 354 (E-value = 4.5e-09) place NG1678 in the Monooxygenase family which is described as Monooxygenase (PF01360)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
20

PDB Hit:
pdb|1BGN|1BGN P-HYDROXYBENZOATE HYDROXYLASE (PHBH) MUTANT WITH 39.1 0.001000
pdb|1L9C|1L9C-A ROLE OF HISTIDINE 269 IN CATALYSIS BY MONOMERIC 39.1 0.001000
pdb|1EL5|1EL5-A COMPLEX OF MONOMERIC SARCOSINE OXIDASE WITH THE 39.1 0.001000
pdb|1L9C|1L9C-A

Gene Protein Sequence:
MSLHSDILVVGAGPAGLSFAAELAGSGLKVTLIERSPLTVLQNPPYDGRE
IALTHFSREIMQRLGMWDKIPENEIYPLRDAKVLNGRSDYQLHFPQPTEA
RGEPADCLGYLISNHNIRRAAYEVVSQLDNVSILTDTAVKEVKTSDNEAQ
VFLENGDILTARLLLAADSRFSQTRRQLGISSDMHDYSRTMFVCRMKHTL
SNQHTAYECFHYGRTIALLPLEKRLTNTVITVDTDKINSVQNLSPEELAA
SVKEQLKGRLGDMELVSSIHHYPLVGMIAKRFYGKRSALIGDAAVGMHPV
TAHGFNLGLSSADILAKLILEAEQRGQDIGAASLLEKYSSKHMLHAHPLY
HGTNMMLKLFTNETAPAKLLRGLVLRAGNNFPPLKKLITKQLTG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTTACACAGCGACATCCTCGTCGTCGGCGCAGGCCCGGCGGGTTT
AAGTTTTGCAGCCGAACTTGCCGGCAGCGGTTTGAAAGTTACTCTGATCG
AACGCAGCCCACTGACTGTTCTGCAAAATCCTCCCTATGACGGACGCGAA
ATCGCCCTGACCCATTTTTCCCGCGAAATCATGCAGCGTTTGGGTATGTG
GGACAAAATTCCCGAAAACGAAATCTACCCCTTGCGCGATGCCAAAGTGC
TGAACGGACGTTCCGACTACCAGCTCCACTTTCCCCAACCGACTGAAGCG
CGCGGCGAGCCTGCCGACTGTTTGGGCTATCTGATTTCCAACCACAATAT
CCGCCGCGCCGCCTATGAAGTCGTATCACAACTCGACAATGTCAGCATTC
TGACCGATACGGCCGTTAAAGAAGTCAAAACATCTGATAATGAAGCGCAA
GTCTTTTTGGAAAATGGAGACATTCTAACCGCGCGTCTCCTTTTGGCAGC
AGACAGCCGTTTCTCACAAACCCGCCGACAACTCGGTATTTCTTCAGATA
TGCACGACTACAGCCGAACCATGTTCGTCTGCCGCATGAAACATACCCTT
TCCAACCAACATACCGCTTACGAATGCTTCCATTACGGACGCACCATCGC
ACTGCTGCCACTGGAAAAGCGCCTGACCAATACCGTCATTACAGTCGATA
CCGATAAAATCAACAGCGTTCAAAACCTTTCGCCCGAAGAATTGGCGGCA
AGCGTAAAAGAACAGCTCAAGGGCAGGCTCGGCGACATGGAACTGGTCAG
CAGCATCCACCATTACCCCCTTGTCGGCATGATTGCCAAACGTTTCTACG
GCAAACGCAGCGCGCTGATCGGCGATGCGGCTGTCGGTATGCACCCCGTA
ACGGCACACGGCTTCAACCTCGGGCTTTCCAGCGCGGATATTCTGGCAAA
ACTGATACTCGAAGCCGAACAGCGCGGTCAAGACATCGGCGCGGCTTCCT
TGTTGGAAAAATACAGCAGCAAACATATGCTGCACGCCCATCCGCTTTAT
CACGGCACCAATATGATGCTGAAACTGTTTACCAACGAAACCGCGCCGGC
AAAACTGTTGCGCGGTTTGGTATTACGAGCCGGCAACAACTTCCCGCCGC
TGAAAAAGCTGATTACCAAACAACTGACCGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy