Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR1367 IGR1369 IGR1372 IGR1373 IGR1364 IGR1365 IGR1371 IGR1368 IGR1370 IGR1366 rpmG, - NG1679 rpmB, - NG1680 NG1674 ispB, - NG1675 farB, - NG1682 pilF, - NG1673 rpmA, - NG1677 rplU, - NG1676 NG1672 pilD, - NG1670 visC, - NG1678 pilG, - NG1669 rpmG, - NG1679 rpmB, - NG1680 NG1674 ispB, - NG1675 farB, - NG1682 pilF, - NG1673 rpmA, - NG1677 rplU, - NG1676 NG1672 pilD, - NG1670 visC, - NG1678 pilG, - NG1669 rpmB, - NG1680 NG1674 ispB, - NG1675 farB, - NG1682 pilF, - NG1673 NG1681 NG1681 rpmG, - NG1679 rplU, - NG1676 pilD, - NG1670 visC, - NG1678 pilG, - NG1669 NG1671 NG1672 rpmA, - NG1677 NG1671
* Calculated from Protein Sequence

Gene ID: NG1675

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ispB  

Definition:
octaprenyl-diphosphate synthase (IspB)

Gene Start:
1631007

Gene Stop:
1630036

Gene Length:
972

Molecular Weight*:
35401

pI*:
4.50

Net Charge*:
-16.06

EC:
2.5.1.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Electron Transport System, Complex IV
Glycoprotein biosynthesis
Porphyrin and chlorophyll metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Asai,K., Fujisaki,S., Nishimura,Y., Nishino,T., Okada,K.,
Nakagawa,T., Kawamukai,M. and Matsuda,H.
The identification of Escherichia coli ispB (cel) gene encoding the octaprenyl diphosphate synthase
Biochem. Biophys. Res. Commun. 202 (1), 340-345 (1994)
Medline: 94311902

Jeong,J.H., Kitakawa,M., Isono,S. and Isono,K.
Cloning and nucleotide sequencing of the genes, rpIU and rpmA, for
ribosomal proteins L21 and L27 of Escherichia coli
DNA Seq. 4 (1), 59-67 (1993)
Medline: 94146411


Comment:
For other 'isp' genes see NG0971 (ispF), NG0972 and NG1735 (ispA).

This protein supplies octaprenyl diphosphate,the precursor for the side chain of the isoprenoid quinones ubiquinone and menaquinone.
This protein belongs to the FPP/GGPP synthetases family.

Oklahoma ID: NGO.1675c

Blast Summary:  PSI-Blast Search
Residues 1-324 are 97% similar to octaprenyl-diphosphate synthase in Neisseria meningitidis group B strain MD58, group A strain Z2491 (11279240|).

Numerous hits in gapped BLAST to octaprenyl-diphosphate synthase sequences,e.g.residues 4-322 are 53% similar to octaprenyl-diphosphate synthase in Escherichia coli K12 (1789578|).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0142
COG name: Geranylgeranyl pyrophosphate synthase
Functional Class:  H
The phylogenetic pattern of COG0142 is AmtkYQVCEBRHUJ--olinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000092 (Polyprenyl synthetase) with a combined E-value of 5.8e-32.
    IPB000092A    45-54
    IPB000092B    75-86
    IPB000092C    87-102
    IPB000092D    147-152
    IPB000092E    205-227


ProDom Summary:  Protein Domain Search
Residues 71-211 are 68% similar to a (SYNTHASE PYROPHOSPHATE TRANSFERASE SYNTHETASE) protein domain (PD000572) which is seen in ISPB_ECOLI.

Residues 213-262 are 66% similar to a (SYNTHASE PYROPHOSPHATE SYNTHETASE TRANSFERASE) protein domain (PD169539) which is seen in ISPB_HAEIN.

Residues 16-64 are 53% similar to a (SYNTHASE OCTAPRENYL-DIPHOSPHATE OCTAPRENYL) protein domain (PD160192) which is seen in ISPB_ECOLI.



Paralogs:  Local Blast Search


NG1675 is paralogously related to NG1735 (geranylgeranyl pyrophosphate synthase; farnesyl-diphosphate synthase) (6e-26).


Pfam Summary:  Pfam Search
Residues 33 to 287 (E-value = 1.8e-89) place NG1675 in the polyprenyl_synt family which is described as Polyprenyl synthetase (PF00348)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1UBX|1UBX STRUCTURE OF FARNESYL PYROPHOSPHATE SYNTHETASE 53.1 7e-08
pdb|1FPS|1FPS AVIAN FARNESYL DIPHOSPHATE SYNTHASE (FPS) 50.8 3e-07
pdb|1UBV|1UBV STRUCTURE OF FARNESYL PYROPHOSPHATE SYNTHETASE 50.8 3e-07
pdb|1UBX|1UBX STRUC

Gene Protein Sequence:
MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLR
PIMTILAGKAVGYDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRAT
ANNLFGNAAAVLVGDFLYTRAFQLMVASGSMRVLEVMADATNIIAEGEVM
QLMNIGNTDITEEQYIRVIQYKTAKLFEAAAQVGAILGKASPGHEQALKD
YGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTLPLIYLMRQGS
EQVANDVRTALENADRGYFEKIRDYVVRSDALAYSIGEARKAVDCAVAAL
DALSDSEVKDAMIQLAKESLVRVS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCGAGAATCTGCCCTATTTCCAGCGACATCTGCCTGAAGACCTTGC
CAAAGTCAATGAAGTCATCAACCGTGCGGTGCAATCCGATGTCGCACTGA
TTTCGCAAATCGGTACATATATCATCAGCGCGGGCGGCAAACGCCTGCGT
CCGATTATGACGATTTTGGCGGGTAAGGCGGTCGGTTATGATGACGAGAA
ACTGTATTCGCTGGCAGCGATGGTCGAGTTTATCCACACTTCCACACTCC
TGCACGACGATGTCGTCGATGAAAGCGATTTGCGCCGTGGGCGGGCAACG
GCAAACAATCTGTTCGGCAATGCGGCGGCAGTGTTGGTTGGCGACTTTTT
ATATACCCGTGCATTTCAACTGATGGTTGCCTCGGGCAGTATGCGCGTTT
TGGAAGTGATGGCGGATGCGACCAACATCATTGCCGAGGGAGAGGTCATG
CAGCTGATGAACATCGGCAATACGGACATTACCGAAGAACAATATATCCG
AGTCATCCAATATAAAACGGCAAAATTGTTTGAAGCTGCCGCTCAAGTCG
GCGCAATTTTGGGCAAAGCTTCCCCCGGGCACGAACAGGCCTTGAAAGAC
TACGGTATGTACGTCGGTACGGCATTCCAGATTATTGACGATGTGCTGGA
TTATTCGGGGGAAACCGAAGAAACAGGTAAAAACGTCGGCGACGATTTGG
CGGAAGGAAAACCGACCCTGCCTTTGATTTATCTGATGCGTCAGGGTTCC
GAACAGGTTGCGAACGATGTGCGTACTGCTTTGGAAAATGCAGATCGCGG
CTATTTTGAAAAAATCCGCGATTATGTCGTCCGTTCGGATGCTTTGGCAT
ATTCGATAGGCGAGGCGCGCAAAGCAGTCGATTGTGCCGTTGCCGCGTTG
GATGCCCTGTCCGACAGCGAAGTGAAGGATGCTATGATTCAGCTGGCGAA
GGAATCTTTGGTCAGGGTGTCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy