Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR1367 IGR1369 IGR1364 IGR1365 IGR1362 IGR1368 IGR1370 IGR1366 IGR1363 NG1674 dapD, - NG1667 ispB, - NG1675 pgi, - NG1668 pilF, - NG1673 rpmA, - NG1677 rplU, - NG1676 NG1672 pilD, - NG1670 pilG, - NG1669 NG1674 dapD, - NG1667 ispB, - NG1675 pgi, - NG1668 pilF, - NG1673 rpmA, - NG1677 rplU, - NG1676 NG1672 pilD, - NG1670 pilG, - NG1669 NG1674 dapD, - NG1667 ispB, - NG1675 pgi, - NG1668 pilF, - NG1673 rplU, - NG1676 pilD, - NG1670 pilG, - NG1669 NG1671 NG1672 rpmA, - NG1677 NG1671
* Calculated from Protein Sequence

Gene ID: NG1671

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
dephospho-CoA kinase

Gene Start:
1626610

Gene Stop:
1627278

Gene Length:
669

Molecular Weight*:
24148

pI*:
9.10

Net Charge*:
1.97

EC:
2.7.1.24  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pantothenate  

Pathway: pathway table
Pantothenate and CoA biosynthesis

Secondary Evidence:
Mishra,P., Park,P.K. and Drueckhammer,D.G.
Identification of yacE (coaE) as the structural gene for
dephosphocoenzyme A kinase in Escherichia coli K-12
J. Bacteriol. 183 (9), 2774-2778 (2001)
Medline: 21189301


Comment:
This protein catalyzes the phosphorylation of the 3'-hydroxyl group of dephospho-coenzyme A to form coenzyme A.

Oklahoma ID: NGO.1671

Blast Summary:  PSI-Blast Search
NG1671 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 2833443.

Residues 14-223 are 96% similar to dephospho-CoA kinase in Neisseria meningitidis group A strain Z2491 (11280058|).

Numerous hits in gapped BLAST to dephospho-CoA kinase sequences, e.g. residues 18-208 are 38% similar to dephospho-CoA kinase in Escherichia coli strain K-12 (2506584|).


COGS Summary:  COGS Search
BeTs to 13 clades of COG0237
COG name: Predicted ATPase
Functional Class:  R
The phylogenetic pattern of COG0237 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001977 (Uncharacterized protein family UPF0038) with a combined E-value of 2.2e-52.
    IPB001977A    18-47
    IPB001977B    67-105
    IPB001977C    119-134
    IPB001977D    155-192


ProDom Summary:  Protein Domain Search
Residues 195-223 are identical to a (HYPOTHETICAL 23.1 KD PROTEIN) protein domain (PD101393) which is seen in YACE_NEIGO.

Residues 18-194 are 98% similar to a (PROTEIN ATP-BINDING 3'REGION CONSERVED) protein domain (PD003329) which is seen in YACE_NEIGO.



Paralogs:  Local Blast Search


NG1671 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 196 (E-value = 1.9e-99) place NG1671 in the CoaE family which is described as Dephospho-CoA kinase (PF01121)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1N3B|1N3B-A CRYSTAL STRUCTURE OF DEPHOSPHOCOENZYME A KINASE 120.0 3e-28
pdb|1JJV|1JJV-A DEPHOSPHO-COA KINASE IN COMPLEX WITH ATP 115.0 6e-27
pdb|1N3B|1N3B-A CRYSTAL STRUCTURE OF DEPHOSPHOCOENZYME A KINASE 313.0 1e-86
pdb|1JJV|1JJV-A DEPH

Gene Protein Sequence:
MAGGQLVADPSGEMTAWVGLTGGIGSGKSAAAQYFADLGVPRIDADAAAH
SLTASDGIALPEIRRLFGDTVFDTQGLLRRDILRKEIFASPSRKALLESV
MLPLIFSEIKKQQETFTDAVYGIVEIPLLTEKRQFISLIRRVLTISAPLE
KRIGRVMARSGLTRGEVADIISHQASESERLLLADDVLLNDGSLKSLREK
TMLLHAFYSGIFASKPTQGKHNG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGGGCGGTCAACTGGTGGCTGACCCATCCGGTGAGATGACAGCATG
GGTCGGACTGACCGGCGGAATCGGCAGCGGCAAATCGGCAGCCGCGCAAT
ATTTTGCCGATTTGGGCGTGCCGCGCATCGATGCGGACGCGGCGGCGCAC
TCGCTGACGGCTTCAGACGGCATCGCCCTGCCGGAAATCAGGCGGCTGTT
CGGCGACACCGTTTTCGACACACAGGGTTTGTTGCGGCGCGACATATTGC
GTAAAGAAATCTTTGCCTCCCCATCGCGCAAAGCCTTGCTCGAATCCGTG
ATGTTGCCGCTGATTTTCTCAGAAATCAAAAAACAGCAAGAAACCTTTAC
CGATGCGGTTTACGGCATTGTCGAAATTCCGCTGCTGACGGAGAAGCGTC
AATTTATCAGCCTGATACGGCGTGTCCTGACCATAAGCGCACCTTTGGAA
AAACGTATCGGCAGGGTAATGGCACGCAGCGGGCTGACGCGCGGCGAGGT
GGCGGACATCATCAGCCATCAGGCATCCGAATCCGAACGCCTGCTGCTTG
CAGACGATGTACTGCTCAATGACGGCAGCCTCAAAAGCCTACGTGAGAAA
ACAATGCTCCTGCACGCGTTTTATTCAGGGATTTTCGCCTCAAAACCAAC
ACAAGGAAAACACAATGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy