Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR1367 IGR1364 IGR1365 IGR1361 IGR1362 IGR1368 IGR1366 IGR1363 NG1674 dapD, - NG1667 ispB, - NG1675 pgi, - NG1668 pilF, - NG1673 NG1672 pilD, - NG1670 pilG, - NG1669 NG1674 dapD, - NG1667 ispB, - NG1675 pgi, - NG1668 pilF, - NG1673 NG1672 pilD, - NG1670 pilG, - NG1669 NG1674 dapD, - NG1667 ispB, - NG1675 pgi, - NG1668 pilF, - NG1673 pilD, - NG1670 pilG, - NG1669 NG1671 NG1672 NG1671
* Calculated from Protein Sequence

Gene ID: NG1670

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pilD  

Definition:
type IV prepilin peptidase (PilD)

Gene Start:
1625792

Gene Stop:
1626649

Gene Length:
858

Molecular Weight*:
31319

pI*:
9.00

Net Charge*:
6.42

EC:
3.4.99.-  

Functional Class:
Cell envelope; Surface structures  
Translation; Protein modification and translation factors  

Pathway: pathway table

Primary Evidence:
Freitag,N.E., Seifert,H.S. and Koomey,M.
Characterization of the pilF-pilD pilus-assembly locus of Neisseria gonorrhoeae
Mol. Microbiol. 16 (3), 575-586 (1995)
Medline: 96037800

Dupuy,B. and Pugsley,A.P.
Type IV prepilin peptidase gene of Neisseria gonorrhoeae MS11:
presence of a related gene in other piliated and nonpiliated
Neisseria strains
J. Bacteriol. 176 (5), 1323-1331 (1994)
Medline: 94156836

Lauer,P., Albertson,N.H. and Koomey,M.
Conservation of genes encoding components of a type IV pilus
assembly/two-step protein export pathway in Neisseria gonorrhoeae
Mol. Microbiol. 8 (2), 357-368 (1993)
Medline: 93302511

Secondary Evidence:
de Groot,A., Heijnen,I., de Cock,H., Filloux,A. and Tommassen,J.
Characterization of type IV pilus genes in plant growth-promoting
Pseudomonas putida WCS358
J. Bacteriol. 176 (3), 642-650 (1994)
Medline: 94131942


Comment:
This protein cleaves type-4 fimbrial leader sequence and methylates the N-terminal (generally PHE) residue.

Oklahoma ID: NGO.1670

For other 'pil' genes, see NG0094 (pilQ), NG0095 (pilP),NG0096 (pilO), NG0097 (pilN), NG0098 (pilM), NG0346 (pilT),NG0348 (pilZ), NG1441 (pilE), NG1669 (pilG), NG0055 (pilC),NG1673 (pilF), NG1908 (pilT), NG1909 (pilT), NG2059 (pilB),NG2060 (pilA).

Blast Summary:  PSI-Blast Search
NG1670 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 996088.

Residues 1-285 in NG1670 have 97% similarity to residues 1-285 in AE002390, N. meningitidis MC58 type IV prepilin peptidase.

Numerous hits in gapped BLAST to type IV prepilin peptidase sequences,e.g.residues 4-274 in NG1670 have 49% similarity to residues 7-279 in X74276, P. putida prepilin peptidase.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1989
COG name: Signal peptidase HopD, cleaves prepilin-like proteins
Functional Class:  N
The phylogenetic pattern of COG1989 is -----qvcEb-h---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00864 (Type IV prepilin cysteine protease (C20) family signature) with a combined E-value of 1.1e-33.
    PR00864A    143-160
    PR00864B    200-210
    PR00864C    211-222
    PR00864D    223-238


ProDom Summary:  Protein Domain Search
Residues 62-159 are 31% similar to a (TYPE 4 PREPILIN-LIKE PROTEIN) protein domain (PD089048) which is seen in LEP3_BACSU.

Residues 27-173 are identical to a (TYPE PEPTIDASE PROTEIN PREPILIN HYDROLASE PROTEASE) protein domain (PD002740) which is seen in LEP3_NEIGO.

Residues 174-282 are identical to a (PEPTIDASE TYPE PROTEIN LEADER) protein domain (PD002186) which is seen in LEP3_NEIGO.

Residues 41-167 are 30% similar to a (BFPP PLASMID) protein domain (PD091360) which is seen in Q57382_ECOLI.

Residues 36-93 are 43% similar to a (PROTEIN ETPN PLASMID ORF2 PILD TYPE IV PREPILIN) protein domain (PD015835) which is seen in O68964_AERSA.



Paralogs:  Local Blast Search


NG1670 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 17 to 127 (E-value = 3.4e-47) place NG1670 in the DiS_P_DiS family which is described as Bacterial Peptidase A24 N-terminal domain (PF06750)
Residues 134 to 243 (E-value = 1.6e-18) place NG1670 in the Peptidase_A24 family which is described as Type IV leader peptidase family (PF01478)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
45
transmembrane  
106  
122
non-globular  
107  
286
transmembrane  
129  
145
transmembrane  
159  
175
transmembrane  
181  
197
transmembrane  
229  
245

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSDLSVLSPFAVPLAAVLGLLVGSFLNVVIYRVPVMMERGWTVFAKEHLN
LPLTDDESRTFNLMKPDSCCPKCRVPIRAWQNIPIVSYLLLRGKCASCQT
KISIRYPLIELLTGVLFGLVAWQYGWSWITLGGLILTAFLISLTFIDADT
QYLPDSMTLPLIWLGLIFNLDGGFVPLQSAVLGAVAGYSSLWLLCAVYKL
LTGKTGMGNGDFKLIAALGAWLGISALPVLIFVSSLIGLVAAIVMRVAKG
RHFAFGPALTVSGWIIFTANDSVWRAVNWWLTHPVR

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGATTTGTCTGTATTGTCGCCGTTTGCCGTGCCTTTGGCAGCAGT
TTTGGGGCTGCTGGTCGGCAGCTTCCTGAATGTCGTCATTTACCGCGTAC
CCGTTATGATGGAACGCGGCTGGACGGTATTTGCCAAAGAACATTTAAAC
CTGCCGCTGACCGACGATGAAAGCCGTACCTTCAACCTGATGAAGCCGGA
TTCCTGCTGTCCCAAATGCCGTGTGCCGATACGCGCGTGGCAGAACATCC
CGATTGTCAGTTACCTGCTCCTGCGCGGCAAATGCGCTTCCTGCCAAACC
AAAATCAGCATACGTTATCCCTTAATCGAGCTGCTGACCGGCGTATTGTT
CGGGCTGGTCGCCTGGCAATACGGCTGGTCTTGGATTACGCTGGGCGGTT
TGATACTGACCGCGTTTCTGATTTCCCTGACCTTTATCGATGCGGACACC
CAATACCTGCCCGACTCGATGACATTACCCTTGATCTGGCTGGGGCTGAT
ATTTAATTTGGACGGCGGCTTCGTGCCTTTGCAGTCTGCCGTTTTAGGTG
CGGTTGCCGGCTATAGTTCATTATGGCTCTTATGTGCAGTGTATAAACTG
CTCACAGGAAAAACCGGTATGGGCAACGGAGATTTCAAACTGATTGCCGC
ATTGGGCGCGTGGCTCGGCATATCCGCATTGCCCGTGCTGATTTTTGTTT
CCTCTCTGATCGGTTTGGTCGCGGCAATCGTTATGCGCGTCGCCAAGGGG
CGGCATTTTGCCTTCGGCCCCGCACTGACAGTTTCGGGCTGGATAATTTT
TACGGCAAACGATTCCGTATGGCGGGCGGTCAACTGGTGGCTGACCCATC
CGGTGAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy