Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1357 IGR1359 IGR1364 IGR1365 IGR1358 IGR1361 IGR1362 IGR1360 IGR1363 NG1663 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 pilF, - NG1673 NG1664 NG1672 pilD, - NG1670 ilvE, - NG1665 pilG, - NG1669 NG1663 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 pilF, - NG1673 NG1664 NG1672 pilD, - NG1670 ilvE, - NG1665 pilG, - NG1669 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 pilF, - NG1673 NG1663 NG1664 pilD, - NG1670 ilvE, - NG1665 pilG, - NG1669 NG1671 NG1672 NG1671
* Calculated from Protein Sequence

Gene ID: NG1668

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgi  

Definition:
glucose-6-phosphate isomerase (Gpi)

Gene Start:
1623977

Gene Stop:
1622337

Gene Length:
1641

Molecular Weight*:
60308

pI*:
6.50

Net Charge*:
-5.95

EC:
5.3.1.9  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Glycolysis / Gluconeogenesis
Pentose phosphate cycle
Starch and sucrose metabolism

Secondary Evidence:
Smith,M.W. and Doolittle,R.F.
Anomalous phylogeny involving the enzyme glucose-6-phosphate
isomerase
J. Mol. Evol. 34 (6), 544-545 (1992)
Medline: 92277670

Froman,B.E., Tait,R.C. and Gottlieb,L.D.
Isolation and characterization of the phosphoglucose isomerase gene from Escherichia coli
Mol. Gen. Genet. 217 (1), 126-131 (1989)
Medline: 89364675


Comment:
Oklahoma ID: NGO.1668c

Blast Summary:  PSI-Blast Search
Residues 1-547 in NG1668 have 95% similarity to residues 1-547 in AL162758, N. meningitidis Z2491 glucose-6-phosphate isomerase 2.

Numerous hits in gapped BLAST to glucose-6-phosphate isomerase sequences,e.g.residues 7-537 in NG1668 have 48% similarity to residues 15-549 in AE004887, P. aeruginosa glucose-6-phosphate isomerase.Residues 7-540 in NG1668 have 47% similarity to residues 9-539 in AE002016, D. radiodurans glucose-6-phosphate isomerase.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0166
COG name: Glucose-6-phosphate isomerase
Functional Class:  G
The phylogenetic pattern of COG0166 is -m--yqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001672 (Phosphoglucose isomerase (PGI)) with a combined E-value of 9.1e-158.
    IPB001672A    77-97
    IPB001672B    130-166
    IPB001672C    179-221
    IPB001672D    235-270
    IPB001672E    315-361
    IPB001672F    373-391
    IPB001672G    412-435
    IPB001672H    476-508


ProDom Summary:  Protein Domain Search
Residues 47-533 are 48% similar to a (ISOMERASE GLUCOSE-6-PHOSPHATE PHOSPHOGLUCOSE) protein domain (PD001107) which is seen in G6PI_DROME.



Paralogs:  Local Blast Search


NG1668 is paralogously related to NG0719 (glucose-6-phosphate isomerase) (1e-143).


Pfam Summary:  Pfam Search
Residues 47 to 533 (E-value = 3.9e-196) place NG1668 in the PGI family which is described as Phosphoglucose isomerase (PF00342)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1IRI|1IRI-A CRYSTAL STRUCTURE OF HUMAN AUTOCRINE MOTILITY 452.0 0e+00
pdb|1IAT|1IAT-A CRYSTAL STRUCTURE OF HUMAN PHOSPHOGLUCOSE 452.0 0e+00
pdb|1JLH|1JLH-A HUMAN GLUCOSE-6-PHOSPHATE ISOMERASE 451.0 0e+00
pdb|1GZD|1GZD-A CRYS

Gene Protein Sequence:
MDAFTRAWYALERHYQDTCHILLRDRFAAEPDRFERMHERLDGMLFDYSK
NRFGEDTLQLLCRLAETADLEGKMRALRTGAKVNGSEGRAALHTALRLPD
GADAVYADGRDVLPEIRRELNRALKFAHSLDDGLYQGITGKRIADFVHIG
IGGSDLGPAMCVQALEPFRRQISVHFVSNADPACLDEVLCRLNPETTMFC
VASKSFKTPETLLNAEAVKAWYRGAGFSESETAHHFCAVSADTEAAQSFG
IAAERVFAMYDWVGGRYSVWSPVGLPVMVAVGGARFRELLAGAHAMDSHF
FHTPPRRNIPVLMALIAVWYNNFQHADGQTAVPYSHNLRLLPAWLNQLDM
ESLGKSRASDGSPAACKTGGIVFGGEGVNCQHAYFQLLHQGTRLIPCDFI
VPMTAQGAEDGRSRFTVANAFAQAEALMKGKTLDEARAELADLPEAERER
LAPHKEFPGNRPSNSILLDRLTPCNLGMLMAAYEHKTFVQGAIWNVNPFD
QWGVEYGKQLAKTIIGELEGGTSVHDASTEGLMAFYRECRLKGGGAA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATGCTTTTACCCGTGCATGGTATGCGCTCGAACGCCATTATCAGGA
TACGTGCCACATCCTTTTGCGCGACCGCTTTGCTGCCGAACCCGACCGTT
TTGAGCGTATGCATGAGCGTTTGGACGGGATGTTGTTCGATTACAGCAAA
AACCGTTTTGGCGAAGATACGCTGCAACTGCTCTGCCGTCTTGCGGAGAC
GGCGGATTTGGAAGGGAAAATGCGTGCTTTGCGGACGGGTGCGAAAGTCA
ACGGCAGCGAGGGGCGTGCCGCGCTGCATACGGCTTTGCGCCTGCCCGAC
GGTGCGGATGCCGTTTATGCGGACGGCAGGGACGTGTTGCCCGAAATCCG
CCGCGAGTTAAATCGTGCGTTGAAGTTTGCACACAGTTTGGACGACGGTT
TATATCAGGGGATAACCGGAAAACGGATTGCGGATTTTGTCCACATCGGC
ATAGGCGGATCCGACCTCGGGCCGGCAATGTGCGTGCAGGCGCTCGAGCC
GTTCAGACGGCAGATTTCCGTCCATTTTGTTTCTAATGCCGACCCTGCCT
GCCTGGATGAGGTCTTATGCCGTCTGAACCCCGAAACAACAATGTTTTGC
GTTGCCAGCAAGTCCTTTAAAACACCGGAAACCCTGCTCAATGCAGAGGC
GGTCAAGGCGTGGTATCGCGGTGCGGGGTTCTCGGAATCCGAAACGGCGC
ACCATTTTTGCGCGGTGTCTGCCGATACGGAAGCGGCGCAAAGTTTCGGC
ATTGCGGCGGAACGCGTGTTTGCGATGTACGACTGGGTGGGCGGACGCTA
TTCCGTCTGGTCGCCCGTCGGTTTGCCCGTGATGGTTGCGGTTGGCGGGG
CGCGTTTCCGCGAACTGCTAGCGGGGGCGCACGCGATGGACAGCCATTTT
TTCCACACGCCCCCGCGTCGCAACATTCCCGTTCTGATGGCACTGATTGC
CGTGTGGTATAACAATTTCCAGCACGCGGACGGGCAGACCGCCGTTCCGT
ACAGCCACAACCTGCGCCTGCTGCCGGCGTGGCTGAACCAGCTCGATATG
GAGAGTTTGGGCAAAAGCCGCGCTTCAGACGGCAGTCCCGCCGCGTGCAA
AACGGGCGGCATCGTGTTCGGCGGTGAAGGGGTCAACTGCCAGCACGCCT
ATTTCCAACTGCTCCACCAAGGCACGCGCCTGATTCCCTGCGACTTTATC
GTCCCGATGACGGCGCAGGGCGCGGAGGACGGACGCAGCCGTTTTACCGT
TGCCAACGCCTTTGCCCAAGCGGAAGCCCTGATGAAGGGTAAAACCTTAG
ACGAAGCACGCGCCGAACTGGCAGATTTGCCCGAAGCGGAACGCGAACGC
CTCGCGCCGCACAAAGAGTTCCCCGGCAACCGCCCCAGCAACAGCATCCT
GCTCGACCGCCTCACGCCCTGCAATCTGGGTATGCTGATGGCGGCTTACG
AACACAAAACCTTCGTCCAAGGCGCGATATGGAACGTCAACCCCTTCGAT
CAGTGGGGGGTTGAGTACGGCAAACAGTTGGCAAAAACCATCATCGGCGA
ACTGGAAGGCGGCACGTCCGTACACGATGCCTCGACCGAAGGGCTGATGG
CGTTTTACCGCGAATGCCGTCTGAAAGGCGGCGGTGCGGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy