Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1357 IGR1359 IGR1356 IGR1364 IGR1358 IGR1361 IGR1362 IGR1360 IGR1363 IGR1355 NG1663 gloA,lguL, - NG1661 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 NG1664 pilD, - NG1670 ilvE, - NG1665 pilG, - NG1669 NG1663 gloA,lguL, - NG1661 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 NG1664 pilD, - NG1670 ilvE, - NG1665 pilG, - NG1669 NG1663 gloA,lguL, - NG1661 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 NG1664 pilD, - NG1670 ilvE, - NG1665 pilG, - NG1669 NG1671 NG1671
* Calculated from Protein Sequence

Gene ID: NG1667

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dapD  

Definition:
2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase (DapD)

Gene Start:
1622124

Gene Stop:
1621306

Gene Length:
819

Molecular Weight*:
29291

pI*:
5.30

Net Charge*:
-3.65

EC:
2.3.1.117  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Lysine biosynthesis

Secondary Evidence:
Richaud,C., Richaud,F., Martin,C., Haziza,C. and Patte,J.C.
Regulation of expression and nucleotide sequence of the Escherichia coli dapD gene
J. Biol. Chem. 259 (23), 14824-14828 (1984)
Medline: 85054973


Comment:
See also: dapA, NG0947; dapB, NG1781; dapE, NG0991; dapF, NG0338.

Oklahoma ID: NGO.1667c

Blast Summary:  PSI-Blast Search
Residues 1-273 in NG1667 have 98% similarity to residues 1-273 in AE002390, N. meningitidis MC58 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase.

Numerous hits in gapped BLAST to 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase sequences,e.g.residues 3-273 in NG1667 have 72% similarity to residues 4-273 in K02970, E. coli tetrahydrodipicolinate N-succinyltransferase.Residues 1-273 in NG1667 have 72% similarity to residues 1-272 in AE006102, P. multocida DapD.

COGS Summary:  COGS Search
BeTs to 4 clades of COG2171
COG name: Tetrahydrodipicolinate N-succinyltransferase
Functional Class:  E
The phylogenetic pattern of COG2171 is ------v-eb-h--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001451 (Bacterial transferase hexapeptide repeat) with a combined E-value of 3.6e-07.
    IPB001451    140-175
    IPB001451    178-213
    IPB001451    134-169
    IPB001451    122-157
    IPB001451    184-219
    IPB001451    128-163
    IPB001451    172-207
    IPB001451    190-225


ProDom Summary:  Protein Domain Search
Residues 3-130 are 59% similar to a (5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SUCCINYLTRANSFERASE) protein domain (PD016271) which is seen in DAPD_ECOLI.

Residues 212-271 are 78% similar to a (5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SUCCINYLTRANSFERASE) protein domain (PD016268) which is seen in DAPD_MYCBO.

Residues 131-211 are 93% similar to a (TRANSFERASE ACYLTRANSFERASE PROTEIN REPEAT BIOSYNTHESIS) protein domain (PD000343) which is seen in DAPD_ECOLI.



Paralogs:  Local Blast Search


NG1667 is paralogously related to NG0085 (pilin glycosylation protein) (6e-04).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1KGQ|1KGQ-A CRYSTAL STRUCTURE OF TETRAHYDRODIPICOLINATE N- 404.0 0e+00
pdb|1TDT|1TDT-A THREE-DIMENSIONAL STRUCTURE OF 386.0 0e+00
pdb|1KGQ|1KGQ-A CRYSTAL STRUCTURE OF TETRAHYDRODIPICOLINATE N- 498.0 0e+00
pdb|1TDT|1TDT-A THRE

Gene Protein Sequence:
MSLQNIIETAFENRADITPTTVAPEVKEAVLETIRQLDSGKLRVAERLGV
GEWKVNEWAKKAVLLSFRIQDNEVLNDGVNKYFDKVPTKFADWSEDEFKN
AGFRAVPGAVARRGSFVAKNAVLMPSYVNIGAYVDEGAMVDTWATVGSCA
QIGKNVHLSGGVGIGGVLEPLQAAPTIIEDNCFIGARSEIVEGAIVEEGS
VISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSLPSKDGSHSLYCA
VIVKRVDAQTRAKTSVNELLRGI

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTTGCAAAACATTATCGAAACCGCCTTTGAAAACCGCGCGGACAT
CACTCCGACCACCGTTGCCCCCGAAGTCAAAGAAGCCGTGTTGGAAACCA
TCCGCCAACTCGATTCAGGCAAACTGCGCGTCGCCGAACGCTTGGGCGTG
GGCGAGTGGAAAGTCAACGAATGGGCGAAAAAAGCCGTGTTGCTGTCCTT
CCGCATCCAAGACAACGAAGTCCTCAACGACGGCGTGAACAAATACTTCG
ACAAAGTGCCGACCAAATTTGCCGACTGGTCTGAAGACGAGTTCAAAAAC
GCAGGCTTCCGCGCAGTTCCGGGTGCGGTTGCCCGACGCGGCAGCTTTGT
TGCCAAAAACGCCGTGCTGATGCCGTCTTACGTCAACATCGGCGCATACG
TCGACGAAGGCGCGATGGTCGATACTTGGGCGACCGTCGGCTCTTGCGCG
CAAATCGGCAAAAACGTCCACTTGAGCGGCGGTGTCGGCATCGGCGGCGT
ACTCGAACCCCTGCAGGCCGCACCCACCATCATTGAAGACAACTGCTTCA
TCGGCGCGCGTTCCGAAATCGTCGAAGGCGCGATTGTCGAAGAAGGCAGC
GTGATTTCGATGGGCGTGTTCATCGGTCAATCCACCAAAATCTTCGACCG
TACCACAGGCGAAATCTACCAAGGCCGCGTACCGGCAGGTTCGGTCGTCG
TGTCCGGCAGCCTGCCTTCCAAAGACGGCAGCCACAGCCTTTACTGTGCC
GTCATCGTCAAACGCGTGGACGCGCAAACCCGCGCCAAAACCAGCGTGAA
CGAACTCTTGCGCGGCATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy